From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03120 [old locus tag: SACOL0603 ]
  • pan locus tag?: SAUPAN002329000
  • symbol: SACOL_RS03120
  • pan gene symbol?: dck
  • synonym:
  • product: deoxynucleoside kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03120 [old locus tag: SACOL0603 ]
  • symbol: SACOL_RS03120
  • product: deoxynucleoside kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 628737..629399
  • length: 663
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (628737..629399) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAATTACGGTATTCCACAAAATGCCATTATAACCATTGCAGGTACAGTTGGTGTT
    GGAAAATCAACACTAACGCAAGCACTTGCAGATAAATTAAACTTTAAAACGTCTTTTGAA
    AATGTCGAACATAATCCATATTTAGATAAATTTTACAGCGATTTTGAACGATGGAGTTTC
    CATTTGCAAATTTACTTCTTAGCTGAACGTTTTAAAGAACAAAAGCGTATGTTTGAATAT
    GGTGGTGGCTTTGTCCAAGATCGATCAATTTATGAAGATGTTGATATTTTTGCAAAAATG
    CATGAAGAAGAAGGCACAATGAGTAAAGAAGATTTCAAAACATATTCAGACTTATTTAAT
    GCCATGGTCATGACACCTTATTTTCCTAAACCTGATGTAATGATTTATTTAGAATGTAAC
    TATGATGAGGTCATTGATCGTATTATTGAACGTGGTCGCGAAATGGAAATTAATACAGAC
    CCTGAATACTGGAAAAAGCTATTTAAACGCTATGACGATTGGATTAATAGCTTTAATGCA
    TGTCCAGTTGTACGTATCAATATTAATGAATATGATATCCATAAGGACCCCGAATCTTTA
    AATCCTATGATAAACAAAATTGCTCGAATTATTCAAACATATCGACAAGTAGATACACGA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03120 [old locus tag: SACOL0603 ]
  • symbol: SACOL_RS03120
  • description: deoxynucleoside kinase
  • length: 220
  • theoretical pI: 4.80408
  • theoretical MW: 26227.5
  • GRAVY: -0.58

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 31.3)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 21.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 18.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Adephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 18.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 17.8)
    Genetic information processingProtein synthesistRNA aminoacylationL-seryl-tRNA(Sec) kinase (TIGR03574; EC 2.7.1.164; HMM-score: 17.5)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 17)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 15.1)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 14.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 13.9)
    UMP-CMP kinase family (TIGR01359; EC 2.7.4.-; HMM-score: 13.5)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 13)
    adenylate kinase (TIGR01360; EC 2.7.4.3; HMM-score: 12.6)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 12.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsadenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 11.9)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 11.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium chelatase ATPase subunit D (TIGR02031; EC 6.6.1.1; HMM-score: 10.1)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) dNK; Deoxynucleoside kinase (PF01712; HMM-score: 211.6)
    AAA_18; AAA domain (PF13238; HMM-score: 46.1)
    Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 23.9)
    AAA_17; AAA domain (PF13207; HMM-score: 22.8)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 20.4)
    AAA_28; AAA domain (PF13521; HMM-score: 20.2)
    Cytidylate_kin2; Cytidylate kinase-like family (PF13189; HMM-score: 18)
    ABC_tran; ABC transporter (PF00005; HMM-score: 17.7)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.6)
    AAA_22; AAA domain (PF13401; HMM-score: 17)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 16.9)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 15.4)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 14.8)
    AAA_33; AAA domain (PF13671; HMM-score: 14.6)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14.5)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.3)
    ATPase; KaiC (PF06745; HMM-score: 14.2)
    SKI; Shikimate kinase (PF01202; HMM-score: 14.1)
    AAA_14; AAA domain (PF13173; HMM-score: 14)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 13.7)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.3)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.3)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 12.5)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.4)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 12.3)
    NACHT; NACHT domain (PF05729; HMM-score: 12.3)
    no clan definedDUF1087; Domain of Unknown Function (DUF1087) (PF06465; HMM-score: 12.3)
    P-loop_NTPase (CL0023) NTPase_1; NTPase (PF03266; HMM-score: 12.2)
    AAA_25; AAA domain (PF13481; HMM-score: 12.1)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 11.8)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 11.8)
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.4
    • Ymax_pos: 31
    • Cmax: 0.387
    • Cmax_pos: 31
    • Smax: 0.62
    • Smax_pos: 28
    • Smean: 0.295
    • D: 0.359
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446990006 NCBI
  • RefSeq: WP_001067262 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFNAMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNACPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03120 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]