From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03450 [old locus tag: SACOL0667 ]
  • pan locus tag?: SAUPAN002478000
  • symbol: SACOL_RS03450
  • pan gene symbol?:
  • synonym:
  • product: HAD family hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03450 [old locus tag: SACOL0667 ]
  • symbol: SACOL_RS03450
  • product: HAD family hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 695745..696464
  • length: 720
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (695745..696464) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGATTTGAATCAAATTAAAGCAGTTGTATTTGATTTAGAAGGTACGTTGTTGGACAGA
    GTTAAATCTCGAGAGAAATTTATCGAAGAGCAATATGAACGATTTCATGACTACTTAATT
    CATGTTCAACTGGCAGATTTTAAAAAAGCATTTATTGAGCTAGATGACGATGAAGATAAT
    GATAAACCTGATTTATATAAAGAAATCATTAAACGTTTCCATGTAGATAGGTTAACTTGG
    AAAGACTTATTTAATGATTTTGAAATGCATTTTTATCGTTATGTATTTCCTTATTACGAT
    ACTTTGTATACACTAGAAAAGCTATCGCAAAAAGGCTTTCAAATTGGTGTTATCGCAAAT
    GGTAAATCTAAGATTAAACAATTTCGATTACATTCACTTGGTTTGATGCATGTTATTAAT
    TATTTATCAACATCAGAAACAGTTGGTTTTCGTAAACCACATCCTAAAATTTTTGAAGAT
    ATGATTGATCAACTAGGGGTATTACCTGAGCAAATTATGTATGTTGGCGATGATGCGTTA
    AATGATGTAGCTCCAGCACGAGCTATGGGCATGGTTAGTGTATGGTATAAACAAGAAGAT
    GCTGAAATTGAACCACTCGAAGAAGAAGTTGATTTTACAATTACAACAGTGGAAGAATTA
    TTAACCATTTTACCAATAAAAAATGATAATAAAGGAGAAAATTATGGATCTATTTACTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03450 [old locus tag: SACOL0667 ]
  • symbol: SACOL_RS03450
  • description: HAD family hydrolase
  • length: 239
  • theoretical pI: 4.54953
  • theoretical MW: 28196.9
  • GRAVY: -0.401255

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 125.6)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 80.2)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 77.8)
    haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 70.5)
    MetabolismEnergy metabolismSugarsphosphoglycolate phosphatase, bacterial (TIGR01449; EC 3.1.3.18; HMM-score: 61.4)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 52.4)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 50.8)
    AHBA synthesis associated protein (TIGR01454; HMM-score: 50.3)
    epoxide hydrolase N-terminal domain-like phosphatase (TIGR02247; HMM-score: 48.2)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 40.3)
    beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 39)
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 35)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 32.7)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesbeta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 31.1)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 27.1)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIA (TIGR01460; HMM-score: 26.4)
    HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 25.5)
    HAD hydrolase, TIGR01548 family (TIGR01548; HMM-score: 23.3)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 22.6)
    MetabolismCentral intermediary metabolismOtherphosphonoacetaldehyde hydrolase (TIGR01422; EC 3.11.1.1; HMM-score: 17.9)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 17.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 16.7)
    HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 16)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 14.1)
    phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 14)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 12.3)
  • TheSEED:
  • PFAM:
    HAD (CL0137) HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 99.4)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 56.2)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 33.6)
    PNK3P; Polynucleotide kinase 3 phosphatase (PF08645; HMM-score: 19)
    PGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 17.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 28
    • Cmax: 0.121
    • Cmax_pos: 24
    • Smax: 0.146
    • Smax_pos: 22
    • Smean: 0.082
    • D: 0.096
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446287499 NCBI
  • RefSeq: WP_000365354 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLADFKKAFIELDDDEDNDKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYTLEKLSQKGFQIGVIANGKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMIDQLGVLPEQIMYVGDDALNDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLTILPIKNDNKGENYGSIY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03450 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]