From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04130 [old locus tag: SACOL0803 ]
  • pan locus tag?: SAUPAN002645000
  • symbol: SACOL_RS04130
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04130 [old locus tag: SACOL0803 ]
  • symbol: SACOL_RS04130
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 825793..826671
  • length: 879
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (825793..826671) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAAAAAATTGTTATTATCGCTGTTTTAGCGATTTTATTTGTAGTAATAAGTGCTTGT
    GGTAATAAAGAAAAAGAGGCACAACATCAATTTACTAAGCAATTTAAAGATGTTGAGCAA
    AAACAAAAAGAATTACAACATGTCATGGATAATATACATTTGAAAGAAATTGATCATCTA
    AGTAAAACTGATACAACTGATAAAAATAGTAAAGAATTTAAGGCACTACAAGAAGATGTT
    AAAAACCATCTCATACCTAAATTTGAAGCATATTATAAGTCAGCAAAAAATTTGCCTGAT
    GATACAATGAAAGTTAAGAAATTAAAAAAAGAATATATGACGCTTGCAAATGAGAAGAAG
    GATGCGATATATCAATTAAAAAAATTCATAGGTTTATGTAATCAATCTATCAAGTATAAC
    GAAGACATTTTAGATTATACGAAACAATTTGAAAAAAATAGATACAAAGTTGAATCAGAA
    ATTAAATTAGCTGATAATAAAAGTGAAGCAACTAATCTTACGACAAAATTAGAACATAAT
    AATAAAGCGTTAAGAGATACTGCGAAGAAGAACCTAGATGATAGTAAAGAAAATGAAGTA
    AAAGGCGCGATTAAAAATCACATTATGCCAATGATTGAAAAGCAAATTACCGATATTAAC
    CAAACTAATATTAGTGATAAGCATGTTAATAATGCAAGGAAAAACGCAATAGAAATGTAT
    TACAGTCTGCAGAACTATTATAATACACGTATTGAAACAATAAAGGTTAGTGAGAAGTTA
    TCAAAAGTCGATGTAGATAAGTTGCCGAAAAAGGGTATAGATATAACTCACGGCGATAAA
    GCCTTTGAAAAAAAGCTTGAAAAATTAGAAGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    879

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04130 [old locus tag: SACOL0803 ]
  • symbol: SACOL_RS04130
  • description: hypothetical protein
  • length: 292
  • theoretical pI: 9.71132
  • theoretical MW: 34082
  • GRAVY: -0.89726

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 9.2)
    Cellular processesCellular processesCell divisioncell division protein FtsL (TIGR02209; HMM-score: 7.2)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 6.8)
    Cellular processesCellular processesSporulation and germinationstage II sporulation protein R (TIGR02837; HMM-score: 4.4)
  • TheSEED:
  • PFAM:
    no clan definedIncA; IncA protein (PF04156; HMM-score: 16.3)
    Ca_hom_mod; Calcium homeostasis modulator (PF14798; HMM-score: 14.4)
    4HB_MCP (CL0457) TarH; Tar ligand binding domain homologue (PF02203; HMM-score: 13.3)
    no clan definedDMPK_coil; DMPK coiled coil domain like (PF08826; HMM-score: 13.3)
    DUF3008; Protein of unknwon function (DUF3008) (PF11450; HMM-score: 12.3)
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 7.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 4.6
    • Cellwall Score: 2.48
    • Extracellular Score: 2.92
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 28 aa
    • Ymax: 0.49
    • Ymax_pos: 28
    • Cmax: 0.324
    • Cmax_pos: 28
    • Smax: 0.909
    • Smax_pos: 18
    • Smean: 0.766
    • D: 0.597
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446647541 NCBI
  • RefSeq: WP_000724887 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKIVIIAVLAILFVVISACGNKEKEAQHQFTKQFKDVEQKQKELQHVMDNIHLKEIDHLSKTDTTDKNSKEFKALQEDVKNHLIPKFEAYYKSAKNLPDDTMKVKKLKKEYMTLANEKKDAIYQLKKFIGLCNQSIKYNEDILDYTKQFEKNRYKVESEIKLADNKSEATNLTTKLEHNNKALRDTAKKNLDDSKENEVKGAIKNHIMPMIEKQITDINQTNISDKHVNNARKNAIEMYYSLQNYYNTRIETIKVSEKLSKVDVDKLPKKGIDITHGDKAFEKKLEKLEEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04130 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]