From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • pan locus tag?: SAUPAN002892000
  • symbol: SACOL_RS04680
  • pan gene symbol?:
  • synonym:
  • product: CsbD family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • symbol: SACOL_RS04680
  • product: CsbD family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 919637..919831
  • length: 195
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (919637..919831) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAAT
    GTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCG
    AAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGT
    AACAAAGGCGAGTAA
    60
    120
    180
    195

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • symbol: SACOL_RS04680
  • description: CsbD family protein
  • length: 64
  • theoretical pI: 4.86657
  • theoretical MW: 7018.64
  • GRAVY: -1.35781

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 57.7)
    no clan definedMT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 14.1)
    YtxH; YtxH-like protein (PF12732; HMM-score: 13.7)
    LEA_4; Late embryogenesis abundant protein (PF02987; HMM-score: 13.4)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 36
    • Cmax: 0.113
    • Cmax_pos: 3
    • Smax: 0.219
    • Smax_pos: 32
    • Smean: 0.142
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446675571 NCBI
  • RefSeq: WP_000752917 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04680 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]