From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04800 [old locus tag: SACOL0936 ]
  • pan locus tag?: SAUPAN003032000
  • symbol: SACOL_RS04800
  • pan gene symbol?: dltB
  • synonym:
  • product: D-alanyl-lipoteichoic acid biosynthesis protein DltB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS04800 [old locus tag: SACOL0936 ]
  • symbol: SACOL_RS04800
  • product: D-alanyl-lipoteichoic acid biosynthesis protein DltB
  • replicon: chromosome
  • strand: +
  • coordinates: 939340..940554
  • length: 1215
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (939340..940554) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGATTCCATATGGTGATTTTACATTCTTCTTAATTGCTTTAATTGCATTATTACCAGTC
    ATTATACTTGGATTTTTAGGTAAGCGAAGTTACATTTATAATGGCGTAGTTACAGCATTT
    ATGATTGTGTTAATCTTTTCTTCTGATAAACATAATCTGTTTGACCAAAAGTATTTAAGT
    GTTCAATTAATTAGTTTTATTATTTACGTCGTATGGCAAGTTTTATTGATAATGTTTTAT
    TATCATTCAAAACCAAAAAATAATTCATTTTCAAAATTTGTAACTGTAATGGTTTTATCA
    ATATTGCCATTAGCACTTGTGAAAGTGTTACAAAGTACATGGTTAGGTGGACATCAGATT
    CACTTCCATGAAAGTAAATTAATTGAATTTGTTGGTTTCTTAGGAATTTCTTATGTTACA
    TTCAAAAGTGTGCAGTTAATTATGGAAATTCGTGATGGTTCTATCAAAGAAATTAAAGTA
    TGGAAATTAATTCAATTTATTTCATTCTTCCCAACGATTTCATCTGGACCAATCGATCGT
    TACAAACGTTTCGTTAAAGACGATAAAAAAGTACCAACAGGCAATGAATATCGTGAATTA
    GTATTAAAAGCAATTCACATGATTATGCTTGGTTTCTTGTATAAATATATTGTTGCTTAC
    TTTATTAACACATATGCAATCATGCCGTTACAATTAGACTTACATGGCTTTGTCAATTTG
    TGGTTATATATGTACGCATACAGCTTATATTTATTCTTTGACTTTGCAGGTTATAGTTTA
    TTTGCGATAGCATTTAGTTATTTATTCGGTATTAAAACACCACCAAACTTCGATAAACCT
    TTCAAAGCGAAAAATATTAAAGATTTCTGGAATAGATGGCATATGACATTATCATTCTGG
    TTCAGAGATTGTATTTACATGAGATCTTTATTCTACATGTCTCGTAAAAAATTATTGAAG
    AGTCAATTTGCAATGTCTAACGTGGCATTCTTAATCAACTTCTTCATAATGGGAATTTGG
    CATGGTATCGAAGTGTATTACATTGTTTATGGTTTATACCATGCAGCATTGTTTATAGGT
    TATGGCTATTATGAACGTTGGCGTAAGAAACATCCGCCACGTTGGCAAAATGGTTTCACA
    ACAGCACTTAGCATTGTGATTACATTCCACTTTGTAACATTTGGCTTTTTAATCTTCTCA
    GGTAAACTTATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1215

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS04800 [old locus tag: SACOL0936 ]
  • symbol: SACOL_RS04800
  • description: D-alanyl-lipoteichoic acid biosynthesis protein DltB
  • length: 404
  • theoretical pI: 10.088
  • theoretical MW: 47774.5
  • GRAVY: 0.493812

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanD-alanyl-lipoteichoic acid biosynthesis protein DltB (TIGR04091; HMM-score: 522.2)
  • TheSEED:
  • PFAM:
    MBOAT-like (CL0517) MBOAT; MBOAT, membrane-bound O-acyltransferase family (PF03062; HMM-score: 72.9)
    MBOAT_2; Membrane bound O-acyl transferase family (PF13813; HMM-score: 31)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 9
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.101
    • Ymax_pos: 11
    • Cmax: 0.124
    • Cmax_pos: 42
    • Smax: 0.144
    • Smax_pos: 3
    • Smean: 0.101
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 10

Accession numbers[edit source | edit]

  • GI: 446536195 NCBI
  • RefSeq: WP_000613541 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLSVQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQIHFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDRYKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNLWLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFWFRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIGYGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS04800 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]