From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05420 [old locus tag: SACOL1063 ]
  • pan locus tag?: SAUPAN003261000
  • symbol: SACOL_RS05420
  • pan gene symbol?:
  • synonym:
  • product: GNAT family N-acetyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05420 [old locus tag: SACOL1063 ]
  • symbol: SACOL_RS05420
  • product: GNAT family N-acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1071691..1072125
  • length: 435
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1071691..1072125) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTTTCAAAAGTAAACAATCAAAAGATGTTAGAAGATTGCTTCTATATAAGAAAGAAA
    GTGTTTGTAGAAGAACAAGGCGTCCCTGAGGAAAGTGAAATTGATGAATATGAATCTGAA
    TCTATTCACCTCATTGGATATGATAATGGACAGCCAGTTGCCACTGCTCGAATACGCCCT
    ATTAATGAAACAACTGTCAAAATAGAACGAGTAGCTGTGATGAAATCACATCGTGGACAA
    GGAATGGGTAGAATGCTTATGCAAGCTGTAGAATCATTAGCTAAAGATGAAGGTTTTTAC
    GTAGCTACTATGAATGCCCAATGTCATGCTATCCCATTTTATGAAAGTTTAAACTTTAAA
    ATGAGAGGTAATATATTTCTTGAGGAAGGCATCGAGCATATTGAAATGACAAAAAAGTTA
    ACCTCGCTTAATTAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05420 [old locus tag: SACOL1063 ]
  • symbol: SACOL_RS05420
  • description: GNAT family N-acetyltransferase
  • length: 144
  • theoretical pI: 5.30054
  • theoretical MW: 16555.9
  • GRAVY: -0.405556

Function[edit source | edit]

  • reaction:
    EC 2.3.1.-?  ExPASy
  • TIGRFAM:
    putative N-acetyltransferase, MSMEG_0567 N-terminal domain family (TIGR04045; HMM-score: 38.8)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 31.4)
    N-acyl amino acid synthase, PEP-CTERM/exosortase system-associated (TIGR03694; EC 2.3.1.-; HMM-score: 17.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesTDP-D-fucosamine acetyltransferase (TIGR02382; HMM-score: 15.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsmycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 15.3)
    Cellular processesCellular processesAdaptations to atypical conditionsdiaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 14.5)
    putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 12.5)
  • TheSEED:
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 80.7)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 59.4)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 44.6)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 27.6)
    Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 26.5)
    Acetyltransf_5; Acetyltransferase (GNAT) domain (PF13444; HMM-score: 23.4)
    FR47; FR47-like protein (PF08445; HMM-score: 20.5)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 15
    • Cmax: 0.105
    • Cmax_pos: 35
    • Smax: 0.285
    • Smax_pos: 7
    • Smean: 0.184
    • D: 0.156
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446414131 NCBI
  • RefSeq: WP_000491986 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLTSLN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05420 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]