From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07880 [old locus tag: SACOL1546 ]
  • pan locus tag?: SAUPAN004036000
  • symbol: SACOL_RS07880
  • pan gene symbol?: proC
  • synonym:
  • product: pyrroline-5-carboxylate reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS07880 [old locus tag: SACOL1546 ]
  • symbol: SACOL_RS07880
  • product: pyrroline-5-carboxylate reductase
  • replicon: chromosome
  • strand: +
  • coordinates: 1582014..1582829
  • length: 816
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1582014..1582829) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAACTCGTATTTTATGGAGCTGGTAATATGGCACAAGCTATATTTACAGGAATTATT
    AACTCAAGCAACTTAGATGCCAATGATATATATTTAACAAATAAATCTAATGAACAAGCT
    TTAAAAGCATTCGCTGAAAAACTAGGTGTTAACTATAGTTATGATGATGCGACATTATTA
    AAAGATGCAGATTATGTATTTTTAGGTACCAAACCACATGATTTTGATGCTCTAGCAACA
    CGCATCAAACCACATATTACAAAAGACAATTGCTTCATTTCAATTATGGCAGGTATTCCG
    ATTGATTATATTAAACAACAATTAGAATGCCAAAATCCAGTTGCTAGAATTATGCCAAAC
    ACAAATGCGCAAGTTGGACACTCTGTTACTGGCATTAGTTTTTCAAACAACTTTGACCCT
    AAATCTAAAGATGAAATTAACGATTTAGTTAAAGCATTTGGTTCTGTAATTGAAGTATCA
    GAAGATCATTTACATCAAGTAACAGCTATCACCGGAAGCGGCCCAGCATTTTTATATCAT
    GTATTCGAGCAATATGTTAAAGCTGGTACGAAACTTGGTCTAGAAAAAGAACAAGTTGAA
    GAATCTATACGCAACCTTATTATAGGTACAAGTAAGATGATTGAACGTTCAGATTTGAGC
    ATGGCTCAATTAAGAAAAAATATTACCTCTAAAGGTGGTACGACACAAGCTGGCCTTGAT
    ACATTGTCACAATATGATTTAGTATCTATTTTCGAAGATTGTCTAAACGCTGCCGTCGAC
    CGTAGTATTGAACTTTCTAATATAGAAGACCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS07880 [old locus tag: SACOL1546 ]
  • symbol: SACOL_RS07880
  • description: pyrroline-5-carboxylate reductase
  • length: 271
  • theoretical pI: 4.76728
  • theoretical MW: 29839.5
  • GRAVY: -0.201476

Function[edit source | edit]

  • reaction:
    EC 1.5.1.2?  ExPASy
    Pyrroline-5-carboxylate reductaseL-proline + NAD(P)+ = 1-pyrroline-5-carboxylate + NAD(P)H
  • TIGRFAM:
    MetabolismAmino acid biosynthesisGlutamate familypyrroline-5-carboxylate reductase (TIGR00112; EC 1.5.1.2; HMM-score: 286.4)
  • TheSEED:
  • PFAM:
    6PGD_C (CL0106) P5CR_dimer; Pyrroline-5-carboxylate reductase dimerisation (PF14748; HMM-score: 94.8)
    NADP_Rossmann (CL0063) F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 60.8)
    GFO_IDH_MocA; Oxidoreductase family, NAD-binding Rossmann fold (PF01408; HMM-score: 16.9)
    PDH; Prephenate dehydrogenase (PF02153; HMM-score: 16.8)
    no clan definedDUF4918; Domain of unknown function (DUF4918) (PF16265; HMM-score: 14.9)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 14.5)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.239
    • Ymax_pos: 28
    • Cmax: 0.184
    • Cmax_pos: 28
    • Smax: 0.419
    • Smax_pos: 22
    • Smean: 0.279
    • D: 0.255
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446702402 NCBI
  • RefSeq: WP_000779748 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKLVFYGAGNMAQAIFTGIINSSNLDANDIYLTNKSNEQALKAFAEKLGVNYSYDDATLLKDADYVFLGTKPHDFDALATRIKPHITKDNCFISIMAGIPIDYIKQQLECQNPVARIMPNTNAQVGHSVTGISFSNNFDPKSKDEINDLVKAFGSVIEVSEDHLHQVTAITGSGPAFLYHVFEQYVKAGTKLGLEKEQVEESIRNLIIGTSKMIERSDLSMAQLRKNITSKGGTTQAGLDTLSQYDLVSIFEDCLNAAVDRSIELSNIEDQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS07880 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]