From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08130 [old locus tag: SACOL1596 ]
  • pan locus tag?: SAUPAN004116000
  • symbol: SACOL_RS08130
  • pan gene symbol?: aroK
  • synonym:
  • product: shikimate kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08130 [old locus tag: SACOL1596 ]
  • symbol: SACOL_RS08130
  • product: shikimate kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 1630028..1630552
  • length: 525
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1630028..1630552) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAATCATGATAAATCACCAATAATTTTAATTGGTTTCATGGGTACCGGTAAATCTACG
    ATTGGTAAATACGTTGCAGATGAGCAAAATTTATCATTTATTGATATAGATTCATATATC
    GAAGAGAAGTATAAGTTAACAATACCAGAAATATTTTGTAAACATGGTGAACAATATTTC
    AGGAATTTAGAGTTCACATGTTTGCAAGAATGTATTAACACTGCAGATATAATTGCTACT
    GGTGGTGGTATTATTGAGAGTGAAGAGGCATTTAATTTTTTGAAAAATCAAAAAAACATT
    ATTTGGTTAGATTGTAATATTGATATTATATATAGTCGAATCAATGATGACCCACATCGA
    CCTAATGCAAATAATAAGACAATCAAGCAGTTAAATGACTTGTATTGCTCGCGGAATTTA
    AGATATAATGAAATCGCATTCAAGAAATTTGATAGTCATTTGCTATCAATTTCAGAAATA
    TATTATGAATTGCTAAATTTAATAAAAGCGAGTGATCAGTATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    525

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08130 [old locus tag: SACOL1596 ]
  • symbol: SACOL_RS08130
  • description: shikimate kinase
  • length: 174
  • theoretical pI: 4.87098
  • theoretical MW: 20221.8
  • GRAVY: -0.344253

Function[edit source | edit]

  • reaction:
    EC 2.7.1.71?  ExPASy
    Shikimate kinaseATP + shikimate = ADP + shikimate 3-phosphate
  • TIGRFAM:
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 19.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Adephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 19.3)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 17.6)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) SKI; Shikimate kinase (PF01202; HMM-score: 146.2)
    AAA_18; AAA domain (PF13238; HMM-score: 32.3)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 20.2)
    AAA_33; AAA domain (PF13671; HMM-score: 15.6)
    AAA_22; AAA domain (PF13401; HMM-score: 15.6)
    Thioredoxin (CL0172) DUF836; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 13.5)
    P-loop_NTPase (CL0023) AAA_24; AAA domain (PF13479; HMM-score: 11.8)
    CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 11.5)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.185
    • Ymax_pos: 27
    • Cmax: 0.189
    • Cmax_pos: 27
    • Smax: 0.277
    • Smax_pos: 22
    • Smean: 0.158
    • D: 0.174
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446937861 NCBI
  • RefSeq: WP_001015117 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYFRNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHRPNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08130 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]