From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08140 [old locus tag: SACOL1597 ]
  • pan locus tag?: SAUPAN004118000
  • symbol: SACOL_RS08140
  • pan gene symbol?: comGF
  • synonym:
  • product: competence protein ComGF

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08140 [old locus tag: SACOL1597 ]
  • symbol: SACOL_RS08140
  • product: competence protein ComGF
  • replicon: chromosome
  • strand: -
  • coordinates: 1630785..1631282
  • length: 498
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1630785..1631282) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATC
    AAAAGACATGTATACAGTATTAATGTCAAAGCTTTTTCGCTCATTGAAATGTTAGTAGCG
    ATGATGGTTATAAGTATAACTTTACTAATTGTTCCAGACTTAATTAGACTTAGTAAAACT
    TTTCTAATTGAAAGTAGGGATTTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT
    CTAGATGATTTTAAAGGAGTAGATAGAAACGATATTGAAATTAGGCAACACCGTATCATT
    TTACATAAAGGTGAAGAAATGATCGAATACAAATTAATTAATAATAAAATTATTAAAGTT
    GTAAATGACAGAGGAAATATAACAATGATTAATAATGTTACAGCATTTACTGCAAATATC
    TACTATAAATCCATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATGTGCAGACT
    AAAACTATTTATGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    498

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08140 [old locus tag: SACOL1597 ]
  • symbol: SACOL_RS08140
  • description: competence protein ComGF
  • length: 165
  • theoretical pI: 10.2218
  • theoretical MW: 19164.7
  • GRAVY: 0.324848

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeSurface structuresprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)
    Cell structureCell envelopeSurface structurestype IV pilus modification protein PilV (TIGR02523; HMM-score: 16.8)
    Genetic information processingProtein fateProtein modification and repairtype IV pilus modification protein PilV (TIGR02523; HMM-score: 16.8)
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein C (TIGR02599; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    no clan definedComGF; Putative Competence protein ComGF (PF15980; HMM-score: 39.2)
    N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 26)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 13
    • Cmax: 0.115
    • Cmax_pos: 58
    • Smax: 0.251
    • Smax_pos: 4
    • Smean: 0.233
    • D: 0.185
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001789864 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08140 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]