From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08850 [old locus tag: SACOL1731 ]
  • pan locus tag?: SAUPAN004306000
  • symbol: SACOL_RS08850
  • pan gene symbol?: dnaI
  • synonym:
  • product: primosomal protein DnaI

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08850 [old locus tag: SACOL1731 ]
  • symbol: SACOL_RS08850
  • product: primosomal protein DnaI
  • replicon: chromosome
  • strand: -
  • coordinates: 1762066..1762986
  • length: 921
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1762066..1762986) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAGCAATTTAAAAGTATAATTAACACGTCGCAGGACTTTGAAAAAAGAATAGAAAAG
    ATAAAAAAAGAAGTAATCAATGACCCAGATGTTAAGCAATTTTTGGAAGCGCATCGAGCT
    GAATTAACGAATGCTATGATTGATGAAGACTTAAATGTGTTACAAGAGTATAAAGATCAA
    CAAAAACATTATGACGGTCATAAATTTGCTGATTGTCCAAATTTCGTAAAGGGGCATGTG
    CCTGAGTTATATGTTGATAATAACCGAATTAAAATACGCTATTTACAATGCCCATGTAAA
    ATCAAGTACGACGAAGAACGCTTTGAAGCTGAGCTAATTACATCTCATCATATGCAACGA
    GATACTTTAAATGCCAAATTGAAAGATATTTATATGAATCATCGAGACCGTCTTGATGTA
    GCTATGGCAGCAGATGATATTTGTACAGCAATAACTAATGGGGAACAAGTGAAAGGCCTT
    TACCTTTATGGTCCATTTGGGACAGGTAAATCTTTTATTCTAGGTGCAATTGCGAATCAG
    CTCAAATCTAAGAAGGTACGTTCGACAATTATTTATTTACCGGAATTTATTAGAACATTA
    AAAGGTGGCTTTAAAGATGGTTCTTTTGAAAAGAAATTACATCGCGTAAGAGAAGCAAAC
    ATTTTAATGCTTGATGATATTGGGGCTGAAGAAGTGACTCCATGGGTGAGAGATGAGGTA
    ATTGGACCTTTGCTACATTATCGAATGGTTCATGAATTACCAACATTCTTTAGTTCTAAT
    TTTGACTATAGTGAATTGGAACATCATTTAGCGATGACTCGTGATGGTGAAGAGAAGACT
    AAAGCAGCACGTATTATTGAACGTGTCAAATCTTTGTCAACACCATACTTTTTATCAGGA
    GAAAATTTCAGAAACAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    921

Protein[edit source | edit]

Protein Data Bank: 5HE8
Protein Data Bank: 5HE9

General[edit source | edit]

  • locus tag: SACOL_RS08850 [old locus tag: SACOL1731 ]
  • symbol: SACOL_RS08850
  • description: primosomal protein DnaI
  • length: 306
  • theoretical pI: 7.15118
  • theoretical MW: 35635.5
  • GRAVY: -0.589543

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 38.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaA regulatory inactivator Hda (TIGR03420; HMM-score: 21)
    AAA family ATPase, CDC48 subfamily (TIGR01243; HMM-score: 17.9)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesproteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 17.3)
    26S proteasome subunit P45 family (TIGR01242; HMM-score: 15.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairorc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 13.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    no clan definedDnaI_N; Primosomal protein DnaI N-terminus (PF07319; HMM-score: 94.4)
    P-loop_NTPase (CL0023) IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 36.8)
    Bac_DnaA; Bacterial dnaA protein (PF00308; HMM-score: 31.3)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 24.5)
    AFG1_ATPase; AFG1-like ATPase (PF03969; HMM-score: 21.6)
    PIF1; PIF1-like helicase (PF05970; HMM-score: 18.6)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 17)
    PhoH; PhoH-like protein (PF02562; HMM-score: 16.2)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14.3)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 13.8)
    KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 13.3)
    AAA_22; AAA domain (PF13401; HMM-score: 13.2)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12.3)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.2)
    AAA_30; AAA domain (PF13604; HMM-score: 12.1)
    DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 11.9)
    T3SS-hook (CL0424) Flg_hook; Flagellar hook-length control protein FliK (PF02120; HMM-score: 11.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 18
    • Cmax: 0.107
    • Cmax_pos: 18
    • Smax: 0.201
    • Smax_pos: 11
    • Smean: 0.141
    • D: 0.133
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446731365 NCBI
  • RefSeq: WP_000808621 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKQFKSIINTSQDFEKRIEKIKKEVINDPDVKQFLEAHRAELTNAMIDEDLNVLQEYKDQQKHYDGHKFADCPNFVKGHVPELYVDNNRIKIRYLQCPCKIKYDEERFEAELITSHHMQRDTLNAKLKDIYMNHRDRLDVAMAADDICTAITNGEQVKGLYLYGPFGTGKSFILGAIANQLKSKKVRSTIIYLPEFIRTLKGGFKDGSFEKKLHRVREANILMLDDIGAEEVTPWVRDEVIGPLLHYRMVHELPTFFSSNFDYSELEHHLAMTRDGEEKTKAARIIERVKSLSTPYFLSGENFRNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08850 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]