From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09090 [old locus tag: SACOL1776 ]
  • pan locus tag?: SAUPAN004386000
  • symbol: SACOL_RS09090
  • pan gene symbol?:
  • synonym:
  • product: 1-acyl-sn-glycerol-3-phosphate acyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09090 [old locus tag: SACOL1776 ]
  • symbol: SACOL_RS09090
  • product: 1-acyl-sn-glycerol-3-phosphate acyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1816469..1817086
  • length: 618
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1816469..1817086) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTATTCAGTGATTAGTAAGATTTTGAATTTCATTTTAGTTAAAATGTCAAAATCATTA
    TACGTAATCGGTAAAGATAATATTCCTAAGGATAGTAAATATGTCGTAACTTGTACGCAT
    GAAAGTTATAACGAAGTCATTATGCTAGGTATGGCATTATATCCTAATCAAATTCATTAT
    ATGGCTAAAAAAGAATTATTCAAAAATAAATGGATTGGTAAATTTTTAACGTCTTTAAAT
    GCATTTCCTGTAGATCGTGAAAATCCAGGACCTAGTACTTTAAAACGCCCAATCAATTTG
    TTGAAAGATAATAAGACAGTTGGTATCTTCCCAACAGGTTCTCGCACATCGCAAGAAGGT
    GCACCTTTGAAACGTGGTGCTTCAACAATTGCAATGTTAAGTAAGTCACCAATATTACCT
    GTTGCTTATGTTGGTCCTACTAAGATTCACGGTCTTTTAACAGGACAAGCATACATAAAT
    ATTGGCAAACCAATCGATATTAACGATTTACCTAAAGATTTAAAACGAAACGAGCGTATC
    GATTATATTACAAAAGAGATTGAAACACGAACAGCAAAGTTACAACAAGAATTGCATGAA
    ATTGTAAAAAGTTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS09090 [old locus tag: SACOL1776 ]
  • symbol: SACOL_RS09090
  • description: 1-acyl-sn-glycerol-3-phosphate acyltransferase
  • length: 205
  • theoretical pI: 10.227
  • theoretical MW: 23073.9
  • GRAVY: -0.245854

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesis1-acylglycerol-3-phosphate O-acyltransferases (TIGR00530; EC 2.3.1.51; HMM-score: 99.1)
  • TheSEED:
  • PFAM:
    Acyltransferase (CL0228) Acyltransferase; Acyltransferase (PF01553; HMM-score: 72.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.227
    • Ymax_pos: 18
    • Cmax: 0.12
    • Cmax_pos: 25
    • Smax: 0.589
    • Smax_pos: 16
    • Smean: 0.421
    • D: 0.303
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446209733 NCBI
  • RefSeq: WP_000287588 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MYSVISKILNFILVKMSKSLYVIGKDNIPKDSKYVVTCTHESYNEVIMLGMALYPNQIHYMAKKELFKNKWIGKFLTSLNAFPVDRENPGPSTLKRPINLLKDNKTVGIFPTGSRTSQEGAPLKRGASTIAMLSKSPILPVAYVGPTKIHGLLTGQAYINIGKPIDINDLPKDLKRNERIDYITKEIETRTAKLQQELHEIVKSL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09090 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]