From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09810 [old locus tag: SACOL1905 ]
  • pan locus tag?: SAUPAN004781000
  • symbol: SACOL_RS09810
  • pan gene symbol?: airR
  • synonym:
  • product: DNA-binding response regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09810 [old locus tag: SACOL1905 ]
  • symbol: SACOL_RS09810
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1960362..1960985
  • length: 624
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1960362..1960985) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAACAAAGTAATATTAGTAGATGACCATTATATTGTGCGACAAGGATTGCGATTTTTA
    TTATCCACGATTGAAAACATAGAAGTTTTACAAGACTTTGCAGATGGAGAAACATTTTTA
    GAATATTTAAAAGAGCATGAGCACCCTGATATTGTGCTATTAGATTTAGTGATGCCTGGC
    ATGAATGGTATTGAAATTACGGAATATATTAAGGCACATTATCCGGATATTAAAGTTTTG
    GTATTAACAAGTTATGTTGATGATGAACATGTAATTTCAGCAATCAATAAAGGTGCTGAT
    GGTTATGAAATGAAAGACGTTGAGCCTCAGCAATTAATTGAAACTATTAGACGAGTTATG
    AACGGTGAAAAAATGATACATCCTAAGGCACAAGATGTATTCGAAACAGTTAGCCAAAAA
    CCACACTACACGAATAAGTTGTCAAAGAGAGAAATTGAAGTGTTACGTGAAATGGTTAAA
    GGTAAAACAAATAAAGAGATTGCAGAAACTTTATTTGTATCTGAAAAAACAATTAAAACA
    CATGTCAGTCATATATTTAGTAAATTACAAGTTAGCGATCGTACACAAGCAGCAATTTAT
    GCAATGGAAAATAAGTTGATTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS09810 [old locus tag: SACOL1905 ]
  • symbol: SACOL_RS09810
  • description: DNA-binding response regulator
  • length: 207
  • theoretical pI: 5.57567
  • theoretical MW: 23895.4
  • GRAVY: -0.27971

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    transcriptional regulator EpsA (TIGR03020; HMM-score: 58.4)
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 57.2)
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 54.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 53.9)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 36.1)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.3)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 35.1)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 33.5)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 23.9)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 23.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 21.8)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21.8)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-H factor (TIGR02859; HMM-score: 17.6)
    probable regulatory domain (TIGR03879; HMM-score: 15.2)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 96.5)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 83)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 23.8)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 18.7)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 17.9)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.9)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.4)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 14)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.8)
    KORA; TrfB plasmid transcriptional repressor (PF16509; HMM-score: 13.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.9)
    no clan definedTraC_F_IV; F pilus assembly Type-IV secretion system for plasmid transfer (PF11130; HMM-score: 12.6)
    HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 37
    • Cmax: 0.121
    • Cmax_pos: 37
    • Smax: 0.169
    • Smax_pos: 31
    • Smean: 0.09
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446967877 NCBI
  • RefSeq: WP_001045133 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPGMNGIEITEYIKAHYPDIKVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQLIETIRRVMNGEKMIHPKAQDVFETVSQKPHYTNKLSKREIEVLREMVKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09810 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]