From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11085 [old locus tag: SACOL2119 ]
  • pan locus tag?: SAUPAN005421000
  • symbol: SACOL_RS11085
  • pan gene symbol?: pyrG
  • synonym:
  • product: CTP synthetase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS11085 [old locus tag: SACOL2119 ]
  • symbol: SACOL_RS11085
  • product: CTP synthetase
  • replicon: chromosome
  • strand: -
  • coordinates: 2179335..2180945
  • length: 1611
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2179335..2180945) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    1561
    ATGACAAAATTTATTTTTGTAACAGGTGGCGTAGTTTCATCATTAGGGAAGGGTATTACA
    GCATCTTCTCTAGGTAGATTATTAAAAGATAGAGGTCTAAATGTAACAATTCAAAAATTC
    GATCCATACTTAAATGTTGACCCAGGTACAATGAGTCCTTATCAACATGGTGAAGTATTC
    GTAACGGATGATGGTGCAGAAACTGACCTAGACTTAGGACATTACGAAAGATTTATTGAT
    ATTAATTTAAACAAGTTTTCAAATGTGACAGCCGGTAAAGTGTATTCACACGTATTGAAA
    AAAGAACGTCGTGGTGATTACTTAGGCGGAACAGTTCAAGTTATTCCGCATATTACAAAT
    GAAATTAAAGAACGTTTATTACTTGCAGGGGAAAGTACGAATGCAGACGTTGTTATCACT
    GAAATTGGCGGTACAACAGGTGATATTGAGTCATTACCGTTTATTGAAGCGATTCGTCAA
    ATTCGTAGCGATTTAGGTAGAGAAAATGTTATGTATGTTCACTGTACATTACTGCCTTAT
    ATTAAAGCTGCTGGAGAAATGAAAACGAAGCCAACACAACATAGTGTTAAAGAATTACGA
    GGCTTAGGTATTCAACCAGACTTAATCGTTGTAAGAACTGAATATGAAATGACACAAGAT
    TTAAAAGATAAAATTGCATTATTCTGTGACATTAATAAAGAAAGTGTTATTGAATGTCGT
    GATGCAGACTCTTTATACGAAATTCCATTACAATTAAGCCAACAAAATATGGATGATATC
    GTTATTAAACGTTTACAATTAAACGCGAAATATGAAACACAGCTTGATGAATGGAAACAG
    TTGTTAGATATCGTTAATAATTTAGATGGTAAAATTACAATTGGTTTAGTAGGTAAATAT
    GTTAGCTTACAAGATGCATATTTATCAGTTGTTGAATCATTGAAACATGCTGGATATCCT
    TTTGCCAAAGATATTGACATTAGATGGATTGATTCAAGTGAAGTAACAGATGAAAATGCA
    GCCGAATACCTTGCAGATGTCGACGGTATTTTAGTACCAGGTGGATTTGGTTTCCGTGCA
    AGTGAAGGTAAAATTAGTGCAATTAAGTATGCTAGAGAAAACAATGTACCATTCTTTGGT
    ATTTGTTTAGGAATGCAACTTGCAACAGTTGAATTTTCAAGAAACGTATTAGGCCTTGAA
    GGCGCACATTCAGCTGAATTAGACCCAGCAACACCATACCCAATTATAGATTTATTACCA
    GAACAAAAAGATATCGAAGATTTAGGTGGTACATTACGCTTAGGCTTATATCCATGTTCA
    ATTAAAGAAGGCACATTGGCACAAGATGTTTATGGTAAAGCGGAAATTGAAGAAAGACAT
    CGTCATCGTTATGAATTTAATAATGACTATAGAGAACAATTAGAAGCAAATGGTATGGTG
    ATTTCTGGTACAAGTCCAGATGGACGTTTAGTAGAAATGGTAGAGATTCCGACAAATGAT
    TTCTTTATTGCTTGTCAATTCCACCCAGAATTCTTATCTAGACCAAATCGTCCGCACCCG
    ATTTTTAAATCATTTATTGAAGCTTCATTAAAATATCAACAAAATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560
    1611

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS11085 [old locus tag: SACOL2119 ]
  • symbol: SACOL_RS11085
  • description: CTP synthetase
  • length: 536
  • theoretical pI: 4.75985
  • theoretical MW: 59991.8
  • GRAVY: -0.258769

Function[edit source | edit]

  • reaction:
    EC 6.3.4.2?  ExPASy
    CTP synthase (glutamine hydrolyzing)ATP + UTP + L-glutamine = ADP + phosphate + CTP + L-glutamate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 850.7)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 31.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 25.4)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 23)
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 15.2)
    MetabolismAmino acid biosynthesisAromatic amino acid familyanthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 9.8)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) CTP_synth_N; CTP synthase N-terminus (PF06418; HMM-score: 425.4)
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 189.4)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 41.4)
    DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 13.8)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 12.9)
    P-loop_NTPase (CL0023) CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL_RS05635pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SACOL_RS05640dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SACOL_RS05645dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SACOL_RS0650530S ribosomal protein S2  [1] (data from MRSA252)
    SACOL_RS0868050S ribosomal protein L21  [1] (data from MRSA252)
    SACOL_RS1168550S ribosomal protein L15  [1] (data from MRSA252)
    SACOL_RS1169530S ribosomal protein S5  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.235
    • Ymax_pos: 22
    • Cmax: 0.16
    • Cmax_pos: 22
    • Smax: 0.526
    • Smax_pos: 6
    • Smean: 0.372
    • D: 0.289
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446082105 NCBI
  • RefSeq: WP_000159960 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECRDADSLYEIPLQLSQQNMDDIVIKRLQLNAKYETQLDEWKQLLDIVNNLDGKITIGLVGKYVSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTDENAAEYLADVDGILVPGGFGFRASEGKISAIKYARENNVPFFGICLGMQLATVEFSRNVLGLEGAHSAELDPATPYPIIDLLPEQKDIEDLGGTLRLGLYPCSIKEGTLAQDVYGKAEIEERHRHRYEFNNDYREQLEANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEASLKYQQNK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS11085 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]