From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12475 [old locus tag: SACOL2376 ]
  • pan locus tag?: SAUPAN005897000
  • symbol: SACOL_RS12475
  • pan gene symbol?: scrA
  • synonym:
  • product: PTS sucrose transporter subunit IIBC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12475 [old locus tag: SACOL2376 ]
  • symbol: SACOL_RS12475
  • product: PTS sucrose transporter subunit IIBC
  • replicon: chromosome
  • strand: -
  • coordinates: 2434264..2435706
  • length: 1443
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2434264..2435706) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    ATGAATTATAAGCAATCCGCAGAAGAAATTTTGAACGCGATAGGCGGAGAAGAGAATTTA
    GATGCAATGGCGCATTGTGCAACGAGACTACGATTAGTTTTAAATGATGAAAGTTTAGTA
    AATGAAGAGGCGCTAAACAATATGGATGTAGTTAAAGGGACGTTTTCTACTGGGGGACAA
    TACCAAATTATTATTGGGTCTGGTACAGTCAATAAAGTATTTAGTGAACTGGAAAAATTA
    ACTGGAAAAGAAGCATCAACCACTTCGGAAGTCAAAGCACAATCTGCTAAAAATATGAAT
    CCGTTACAGCGATTTGTAAAAATGCTTTCAGATATCTTTGTTCCGATTATACCAGCCATC
    GTTGCTGGTGGTTTATTAATGGGGTTAAATAACATTTTGACTGCGAAAGATTTATTCTTT
    TCAGGTAAATCATTGATAGATGTATATAGTCAATTTGCTGGATTAGCTGAAATGATAAAT
    GTTTTTGCGAATGCACCATTTACATTATTACCAATTTTAATTGGATTTAGTGCAGCAAAA
    CGCTTTGGTGGCAATCCATTTTTAGGTGCTGCATTAGGTATGATACTAGTTCATCCATCG
    CTAATGAGCGCATACGATTTCCCAAAAGCAGTTGAAGCAGGTAAGGCTATTCCATATTGG
    GATGTTTTTGGTTTGCATATTAATCAAGTAGGTTATCAAGGACAAGTGTTACCTATGCTT
    GTAGCAGCTTATATCTTAGCCTCAATTGAAAAAGGGTTACGCAAAGTTATTCCAACGGTG
    TTAGATAATTTGTTAACACCATTGTTATCTATTTTTATAACAGCATTTCTAACATTTTCA
    TTTGTAGGTCCAATCACTCGACAATTAGGTTACTGGTTATCAGATGGTTTAACATGGCTT
    TATGAATTTGGTGGTGCAATTGGTGGATTAATATTCGGATTATTGTATGCTCCGATTGTT
    ATTACAGGTATGCATCATAGCTTTATAGCTGTAGAAACGACATTAATTGCAGATGCCACT
    AAAACGGGTGGATCATTTATATTCCCGATTGCGACAATGTCTAATGTTGCACAAGGTGGT
    GCAGCAATTGCAGCGTTCTTTATTATTAAACAAAATAAGAAGTTAAAAGGTGTGGCATCT
    GCCGCAGGTATTTCAGCATTACTTGGTATTACAGAACCGGCTATGTTTGGTGTTAACTTA
    AAACTAAGATATCCATTTATTGGCGCTATCGTTGGATCAGGTATTGGTTCAGCATATATT
    GCTTTCTTCAAGGTTAAAGCAATCGCATTAGGAACTGCTGGATTGCCAGGATTTATTTCA
    ATCAATCCAGTACATGCAGGATGGTTACACTACTTTGTTGGTATGACAATATCATTCATC
    ATTGCTATAACAGTTACTTTAATTTTATCTAAAAGAAAAGCAAATAAAGAAGTTGTAGAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1443

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12475 [old locus tag: SACOL2376 ]
  • symbol: SACOL_RS12475
  • description: PTS sucrose transporter subunit IIBC
  • length: 480
  • theoretical pI: 9.25364
  • theoretical MW: 51217.9
  • GRAVY: 0.579583

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    PTS system, sucrose-specific IIBC component (TIGR01996; EC 2.7.1.69; HMM-score: 676.1)
    PTS system, trehalose-specific IIBC component (TIGR01992; EC 2.7.1.69; HMM-score: 553.8)
    PTS system, beta-glucoside-specific IIABC component (TIGR01995; EC 2.7.1.69; HMM-score: 369.4)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, maltose and glucose-specific subfamily, IIC component (TIGR00852; HMM-score: 273.1)
    Signal transductionSignal transductionPTSPTS system, maltose and glucose-specific subfamily, IIC component (TIGR00852; HMM-score: 273.1)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, glucose-like IIB component (TIGR00826; EC 2.7.1.69; HMM-score: 86.5)
    Signal transductionSignal transductionPTSPTS system, glucose-like IIB component (TIGR00826; EC 2.7.1.69; HMM-score: 86.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, N-acetylglucosamine-specific IIBC component (TIGR01998; EC 2.7.1.69; HMM-score: 41.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, alpha-glucoside-specific IIBC component (TIGR02005; EC 2.7.1.69; HMM-score: 38.4)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, maltose and glucose-specific IIBC component (TIGR02004; EC 2.7.1.69; HMM-score: 35.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, glucose-specific IIBC component (TIGR02002; EC 2.7.1.69; HMM-score: 27.1)
    glycopeptide, sublancin family (TIGR04196; HMM-score: 13.8)
  • TheSEED:
  • PFAM:
    PTS_EIIC (CL0493) PTS_EIIC; Phosphotransferase system, EIIC (PF02378; HMM-score: 206.5)
    no clan definedPTS_EIIB; phosphotransferase system, EIIB (PF00367; HMM-score: 52.3)
    GPCR_A (CL0192) Ceramidase; Ceramidase (PF05875; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 10
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.13
    • Ymax_pos: 45
    • Cmax: 0.126
    • Cmax_pos: 25
    • Smax: 0.24
    • Smax_pos: 40
    • Smean: 0.097
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 8

Accession numbers[edit source | edit]

  • GI: 447030870 NCBI
  • RefSeq: WP_001108126 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNYKQSAEEILNAIGGEENLDAMAHCATRLRLVLNDESLVNEEALNNMDVVKGTFSTGGQYQIIIGSGTVNKVFSELEKLTGKEASTTSEVKAQSAKNMNPLQRFVKMLSDIFVPIIPAIVAGGLLMGLNNILTAKDLFFSGKSLIDVYSQFAGLAEMINVFANAPFTLLPILIGFSAAKRFGGNPFLGAALGMILVHPSLMSAYDFPKAVEAGKAIPYWDVFGLHINQVGYQGQVLPMLVAAYILASIEKGLRKVIPTVLDNLLTPLLSIFITAFLTFSFVGPITRQLGYWLSDGLTWLYEFGGAIGGLIFGLLYAPIVITGMHHSFIAVETTLIADATKTGGSFIFPIATMSNVAQGGAAIAAFFIIKQNKKLKGVASAAGISALLGITEPAMFGVNLKLRYPFIGAIVGSGIGSAYIAFFKVKAIALGTAGLPGFISINPVHAGWLHYFVGMTISFIIAITVTLILSKRKANKEVVE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12475 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]