From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13040 [old locus tag: SACOL2488 ]
  • pan locus tag?: SAUPAN006056000
  • symbol: SACOL_RS13040
  • pan gene symbol?:
  • synonym:
  • product: oxidoreductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS13040 [old locus tag: SACOL2488 ]
  • symbol: SACOL_RS13040
  • product: oxidoreductase
  • replicon: chromosome
  • strand: -
  • coordinates: 2543619..2544314
  • length: 696
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2543619..2544314) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACAGTATTAACAGATAAAGTAGCAGTAGTTACAGGTGCAGGTAGTGGTATTGGAGAA
    GCAATTGCAACATTACTACATGAAGAAGGGGCAAAAGTTGTCTTAGCAGGTAGAAATAAA
    GAAAAATTACAAAACGTAGCGAATCAATTGTCACAAGATAGTGTGAAGGTAGTGCCAACA
    GATGTAACGAATAAAGAAGAAGTCGATGAATTGATAAAAATTGCACAACAAACATTCGGT
    GGTTTGGATATTGTTATCAATAGTGCGGGGCAAATGTTGTCGTCTAAGATTACTGATTAT
    CAAGTAGATGAGTGGGATAGTATGATTGATGTGAATATCAAAGGCACTTTATATACGGCA
    CAGGCTGCATTACCAACTATGTTAGAACAATCAAGTGGCCATCTTATTAACATTGCATCT
    ATTTCTGGCTTTGAAGTAACGAAAAGTAGTACGATTTATAGTGCGACGAAAGCAGCAGTT
    CACACTATTACTCAAGGATTAGAAAAAGAGTTGGCAAAGACAGGCGTTAAAGTAACAAGC
    ATTTCTCCAGGAATGGTAGATACAGCCATAACTGCCGCATACAATCCAACAGATCGTAAA
    AAACTTGAACCACAAGATATTGCAGAAGCAGTATTATATGCATTAACACAACCAAAGCAC
    GTTAACGTGAATGAAATTACAGTGCGTCCTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS13040 [old locus tag: SACOL2488 ]
  • symbol: SACOL_RS13040
  • description: oxidoreductase
  • length: 231
  • theoretical pI: 4.91397
  • theoretical MW: 24603.9
  • GRAVY: -0.0290043

Function[edit source | edit]

  • reaction:
    EC 1.-.-.-?  ExPASy
  • TIGRFAM:
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 155.3)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 149.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 147.8)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 126.4)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 125.5)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 124.7)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 123.5)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 119.2)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 117)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 114.8)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 83.7)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 80)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 58.3)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 46.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 34.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminglutamyl-tRNA reductase (TIGR01035; EC 1.2.1.70; HMM-score: 21)
    Hypothetical proteinsConservedTIGR01777 family protein (TIGR01777; HMM-score: 20)
    MetabolismAmino acid biosynthesisAromatic amino acid familyshikimate dehydrogenase (TIGR00507; EC 1.1.1.25; HMM-score: 19.9)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 17.1)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein PilL, PFGI-1 class (TIGR03748; HMM-score: 16.4)
    Unknown functionEnzymes of unknown specificityputative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 15.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 11.3)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS11 (TIGR03632; HMM-score: 11.1)
    MetabolismFatty acid and phospholipid metabolismBiosynthesishopanoid C-3 methylase HpnR (TIGR04367; HMM-score: 10.8)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) adh_short; short chain dehydrogenase (PF00106; HMM-score: 195.7)
    adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 163.9)
    KR; KR domain (PF08659; HMM-score: 59.8)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 41.6)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 38.5)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 30.8)
    Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 26.6)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 24.6)
    3HCDH_N; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737; HMM-score: 23.4)
    NmrA; NmrA-like family (PF05368; HMM-score: 21.6)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 21.3)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 19.5)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 19.4)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 19.4)
    S11_L18p (CL0267) Ribosomal_S11; Ribosomal protein S11 (PF00411; HMM-score: 17.2)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 17.1)
    no clan definedArg_tRNA_synt_N; Arginyl tRNA synthetase N terminal domain (PF03485; HMM-score: 16.2)
    Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 14.8)
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 14.6)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 14.1)
    HUP (CL0039) ETF; Electron transfer flavoprotein domain (PF01012; HMM-score: 13.7)
    NADP_Rossmann (CL0063) DUF1776; Fungal family of unknown function (DUF1776) (PF08643; HMM-score: 13.6)
    T3SS-hook (CL0424) Flg_hook; Flagellar hook-length control protein FliK (PF02120; HMM-score: 13.6)
    RNase_H (CL0219) DDE_Tnp_1_3; Transposase DDE domain (PF13612; HMM-score: 13.4)
    no clan definedNitro_FeMo-Co; Dinitrogenase iron-molybdenum cofactor (PF02579; HMM-score: 13.2)
    NADP_Rossmann (CL0063) IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 13)
    no clan definedGlyco_tran_WecB; Glycosyl transferase WecB/TagA/CpsF family (PF03808; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.188
    • Ymax_pos: 24
    • Cmax: 0.144
    • Cmax_pos: 24
    • Smax: 0.332
    • Smax_pos: 20
    • Smean: 0.218
    • D: 0.199
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446139611 NCBI
  • RefSeq: WP_000217466 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS13040 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]