From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00215
  • pan locus tag?: SAUPAN001117000
  • symbol: SAOUHSC_00215
  • pan gene symbol?:
  • synonym:
  • product: PTS system transporter

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00215
  • symbol: SAOUHSC_00215
  • product: PTS system transporter
  • replicon: chromosome
  • strand: +
  • coordinates: 235347..235625
  • length: 279
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAAT
    GCAATTGAAGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATT
    ACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAA
    AAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAA
    GAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA
    60
    120
    180
    240
    279

Protein[edit source | edit]

Protein Data Bank: 5GQS

General[edit source | edit]

  • locus tag: SAOUHSC_00215
  • symbol: SAOUHSC_00215
  • description: PTS system transporter
  • length: 92
  • theoretical pI: 5.86126
  • theoretical MW: 10178.8
  • GRAVY: -0.105435

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    Signal transductionSignal transductionPTSPTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
    Signal transductionSignal transductionPTSPTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
  • TheSEED:  
    CarbohydratesMonosaccharidesD-Tagatose and Galactitol Utilization PTS system, galactitol-specific IIB component (EC 2.7.1.69) 
  • PFAM:
    Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 63.3)
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.504
    • Ymax_pos: 27
    • Cmax: 0.557
    • Cmax_pos: 27
    • Smax: 0.73
    • Smax_pos: 19
    • Smean: 0.462
    • D: 0.488
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]