From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00249
  • pan locus tag?: SAUPAN001164000
  • symbol: SAOUHSC_00249
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00249
  • symbol: SAOUHSC_00249
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 268755..269414
  • length: 660
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATAGAAATTAATAACCTTTCAAAGCGTTACCGTAACAAACAGATTTTCAATCATTTA
    ACTATGTCCTTTGATAGTAATCGTTTAACCGTATTACTTGGTGATAATGGTGCTGGAAAA
    TCAACATTACTTCGTATGATTGCTGGTATTGAAAAAGCTAATGATGGAACTATCAACTAT
    TTCGGCGAAAAATGGAATCAAAGACAAATACAAAATCACATCGGTTATGTGCCACAAGAC
    ATTGCGTTATTTGAACACATGACAGTGGCTGAAAACATTAAATTTTTTAAATCACTTTGT
    AAAAATCCAATTAACGATACAACTATCAACGAATATTTACAGCAATTAAACTTTGATGAT
    ACGTCTGCCAAAGTATCTACATTGTCCGGTGGGAATAAACGTAAAATTAATATATTAGTA
    GGTTTACTAGGTCAACCTCGAATTCTCATTTTAGATGAACCGACAGTTGGTATTGATTTA
    AAATCTAGACATGACATCCACCAACTACTTAACATCATGAAATCTAAATGTTTAATTATA
    TTAACTACCCATCATTTAGATGAAGTTGAAGCACTTGCAGATGATATCAAGTTAATTGGC
    CAAGATCCTTTTTATCAACATGTTTTAGAGGACAAACAATGGACTTATACCTATTATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00249
  • symbol: SAOUHSC_00249
  • description: hypothetical protein
  • length: 219
  • theoretical pI: 7.27079
  • theoretical MW: 25161.7
  • GRAVY: -0.33105

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 143.2)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 136.3)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 135.2)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 124.5)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 106.9)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 105.8)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 104.4)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 103.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 101.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 99.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 98.3)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 95.9)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 92.4)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 91.3)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 91.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 90.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 90.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.2)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 87.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 87.5)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 87.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 85.3)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 81.2)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 80)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.5)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 78.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.2)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 75.4)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 74.6)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 69.2)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 68.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 63.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 62.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 62.2)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 53.4)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 52.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 52.5)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.3)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 48.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 45.5)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 43.2)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 36.3)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 31.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 30.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 27.4)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 27.4)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 25.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA repair protein RecN (TIGR00634; HMM-score: 15.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecF (TIGR00611; HMM-score: 13.3)
    Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 13.1)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 12.7)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.3)
    Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 12)
    Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.6)
    MetabolismEnergy metabolismATP-proton motive force interconversionATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 11.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EccCb (TIGR03925; HMM-score: 11.2)
  • TheSEED:  
    ABC transporter ATP-binding protein 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.1)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 44.6)
    AAA_23; AAA domain (PF13476; HMM-score: 32.2)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 25.5)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.8)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.3)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.6)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.1)
    AAA_30; AAA domain (PF13604; HMM-score: 18)
    AAA_13; AAA domain (PF13166; HMM-score: 16.5)
    AAA_27; AAA domain (PF13514; HMM-score: 16)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 15.3)
    NACHT; NACHT domain (PF05729; HMM-score: 14.8)
    DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 14.7)
    AAA_22; AAA domain (PF13401; HMM-score: 14.1)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.8)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.7)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.6)
    NTPase_1; NTPase (PF03266; HMM-score: 12.5)
    SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 11.9)
    PhoH; PhoH-like protein (PF02562; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 14
    • Cmax: 0.13
    • Cmax_pos: 54
    • Smax: 0.287
    • Smax_pos: 6
    • Smean: 0.229
    • D: 0.182
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]