Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0271 [new locus tag: SAUSA300_RS01455 ]
- pan locus tag?: SAUPAN001164000
- symbol: SAUSA300_0271
- pan gene symbol?: —
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0271 [new locus tag: SAUSA300_RS01455 ]
- symbol: SAUSA300_0271
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 323345..324004
- length: 660
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914270 NCBI
- RefSeq: YP_492985 NCBI
- BioCyc: GH3C-267 BioCyc
- MicrobesOnline: 1291786 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGATAGAAATTAATAACCTTTCAAAGCGTTACCGTAACAAACAGATTTTCAATCATTTA
ACTATGTCCTTTGATAGTAATCGTTTAACCGTATTACTTGGTGATAATGGTGCTGGAAAA
TCAACATTACTTCGTATGATTGCTGGTATTGAAAAAGCTAATGATGGAACTATCAACTAT
TTCGGCGAAAAATGGAATCAAAGACAAATACAAAATCACATCGGTTATGTGCCACAAGAC
ATTGCGTTATTTGAACACATGACAGTGGCTGAAAACATTAAATTTTTTAAATCACTTTGT
AAAAATCCAATTAACGATACAACTATCAACGAATATTTACAGCAATTAAACTTTGATGAT
ACGTCTGCCAAAGTATCTACATTGTCCGGTGGGAATAAACGTAAAATTAATATATTAGTA
GGTTTACTAGGTCAACCTCGAATTCTCATTTTAGATGAACCGACAGTTGGTATTGATTTA
AAATCTAGACATGACATCCACCAACTACTTAACATCATGAAATCTAAATGTTTAATTATA
TTAACTACCCATCATTTAGATGAAGTTGAAGCACTTGCAGATGATATCAAGTTAATTGGC
CAAGATCCTTTTTATCAACATGTTTTAGAGGACAAACAATGGACTTATACCTATTATTAA60
120
180
240
300
360
420
480
540
600
660
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0271 [new locus tag: SAUSA300_RS01455 ]
- symbol: SAUSA300_0271
- description: ABC transporter ATP-binding protein
- length: 219
- theoretical pI: 7.27079
- theoretical MW: 25161.7
- GRAVY: -0.33105
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 143.2)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 136.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 135.2)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 124.5)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)and 72 moregliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 106.9)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 105.8)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 104.4)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 103.5)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 101.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 99.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 98.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 95.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 92.4)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 91.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 91.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 90.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 90.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 87.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 87.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 87.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 85.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 81.2)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 80)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.5)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 78.8)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 75.4)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 74.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 69.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 68.9)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 62.8)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 62.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 53.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 52.7)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 52.5)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.3)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 48.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 45.5)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 43.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 36.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 31.6)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 30.9)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 27.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 27.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 25.1)DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 15.3)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 13.3)DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 13.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.7)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.3)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 12)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.6)Energy metabolism ATP-proton motive force interconversion ATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 11.4)Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.2)
- TheSEED :
- ABC transporter ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.1)and 20 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 44.6)AAA_23; AAA domain (PF13476; HMM-score: 32.2)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 25.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.8)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.3)AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.6)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.1)AAA_30; AAA domain (PF13604; HMM-score: 18)AAA_13; AAA domain (PF13166; HMM-score: 16.5)AAA_27; AAA domain (PF13514; HMM-score: 16)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 15.3)NACHT; NACHT domain (PF05729; HMM-score: 14.8)DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 14.7)AAA_22; AAA domain (PF13401; HMM-score: 14.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.8)Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.7)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.6)NTPase_1; NTPase (PF03266; HMM-score: 12.5)SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 11.9)PhoH; PhoH-like protein (PF02562; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019845
- TAT(Tat/SPI): 0.000411
- LIPO(Sec/SPII): 0.000806
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.