From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001164000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter family protein
    • putative ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter, ATP-binding protein
  • strand?: -
  • coordinates?: 1435292..1435951
  • synteny block?: BlockID0006840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0277
    08BA02176:
    C248_0267
    11819-97:
    MS7_0268
    71193:
    ST398NM01_0292
    ECT-R 2:
    ECTR2_238
    ED133:
    SAOV_0218
    ED98:
    SAAV_0245
    HO 5096 0412:
    SAEMRSA15_02360
    JH1:
    SaurJH1_0268
    JH9:
    SaurJH9_0261
    JKD6008:
    SAA6008_00251
    JKD6159:
    SAA6159_00255
    LGA251:
    SARLGA251_02410
    M013:
    M013TW_0258
    MRSA252:
    SAR0274
    MSHR1132:
    SAMSHR1132_02430
    MSSA476:
    SAS0253
    Mu3:
    SAHV_0275
    Mu50:
    SAV0277
    MW2:
    MW0253
    RF122:
    SAB0216c
    ST398:
    SAPIG0292
    T0131:
    SAT0131_00272
    TCH60:
    HMPREF0772_10223
    TW20:
    SATW20_02790
    USA300_TCH1516:
    USA300HOU_0290
    VC40:
    SAVC_01130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINY
    N315            MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINY
    NCTC8325        MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINY
    Newman          MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINY
    USA300_FPR3757  MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINY
                    ************************************************************

    COL             FGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDD
    N315            FGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDD
    NCTC8325        FGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDD
    Newman          FGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDD
    USA300_FPR3757  FGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDD
                    ************************************************************

    COL             TSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLII
    N315            TSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLII
    NCTC8325        TSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLII
    Newman          TSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLII
    USA300_FPR3757  TSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLII
                    ************************************************************

    COL             LTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY
    N315            LTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWAYTYY
    NCTC8325        LTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY
    Newman          LTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY
    USA300_FPR3757  LTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY
                    **********************************:****