From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00717
  • pan locus tag?: SAUPAN002594000
  • symbol: SAOUHSC_00717
  • pan gene symbol?: saeP
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00717
  • symbol: SAOUHSC_00717
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 701725..702165
  • length: 441
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATACAAAATATTTTTTAGCAGCTGGTGCTGTTATCACAACATTAGCTTTAGGTGCT
    TGTGGTAATTCTAATTCACAAGATCAAGGTAACAAAACTGAACAAAAAACAAAGTCAGAA
    GATAGCAATGTTAAAACTGATAAAACAAAACACCTAACAGGTACATTCAGTTCTAAAAAC
    GGTGAAACTGTTGAAGGTAAAGCTGAGATTAAAAATGGTAAATTAATGCTTACTAACTAC
    AAATCATCAAAAGGTCCAGATTTATACGTCTACCTAACAAAAAATGGCGACATTAAAAAC
    GGTAAAGAAATCGCAATGGTTGACTACGATAAAGAAAAACAAACATTTGATCTTAAAAAT
    GTAGATTTAAGCAAATATGATGAAGTAACAATCTATTGTAAAAAAGCTCACGTCATCTTC
    GGCGGCGCTAAATTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    441

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00717
  • symbol: SAOUHSC_00717
  • description: hypothetical protein
  • length: 146
  • theoretical pI: 9.62012
  • theoretical MW: 16045.1
  • GRAVY: -0.739041

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01107853: hypothetical protein 
  • PFAM:
    no clan definedDM13; Electron transfer DM13 (PF10517; HMM-score: 41.9)
    DUF1797; Protein of unknown function (DUF1797) (PF08796; HMM-score: 16)
    YcgL; YcgL domain (PF05166; HMM-score: 12.6)
    CfAFP; Choristoneura fumiferana antifreeze protein (CfAFP) (PF05264; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LALGACG
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.496
    • Ymax_pos: 27
    • Cmax: 0.313
    • Cmax_pos: 27
    • Smax: 0.866
    • Smax_pos: 22
    • Smean: 0.754
    • D: 0.597
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKNGETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKNVDLSKYDEVTIYCKKAHVIFGGAKLK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]