From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00892
  • pan locus tag?: SAUPAN003057000
  • symbol: SAOUHSC_00892
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00892
  • symbol: SAOUHSC_00892
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 855577..855921
  • length: 345
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    GTGCGTGTAACTGGTATTCAACCATACGGTGCGTTTGTTGAGACCCCTAATCATACTGAA
    GGACTGATTCATATATCAGAAATTATGGATGACTACGTTCATAATTTGAAGAAATTTCTA
    TCAGAAGGCCAAATTGTTAAAGCTAAAATTTTGTCTATAGATGATGAAGGAAAGCTTAAT
    CTATCATTAAAGGATAATGATTACTTCAAAAATTATGAGCGTAAGAAGGAAAAACAATCA
    GTATTAGATGAAATCAGAGAAACAGAAAAATATGGGTTTCAAACACTTAAAGAACGCTTA
    CCAATCTGGATAAAACAGTCAAAGCGAGCAATTCGAAACGACTAA
    60
    120
    180
    240
    300
    345

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00892
  • symbol: SAOUHSC_00892
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 8.81649
  • theoretical MW: 13427.2
  • GRAVY: -0.791228

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionDegradation of RNApolyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 52.7)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bS1 (TIGR00717; HMM-score: 48)
    Genetic information processingTranscriptionDegradation of RNAribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 21.8)
    guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 20.8)
  • TheSEED:  
    General stress protein 13 
  • PFAM:
    OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 46.5)
    no clan definedUAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 18.5)
    TRB (CL0206) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 49
    • Cmax: 0.122
    • Cmax_pos: 49
    • Smax: 0.14
    • Smax_pos: 48
    • Smean: 0.079
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]