From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003057000
  • symbol?:
  • description?: polyribonucleotide nucleotidyltransferase

      descriptions from strain specific annotations:

    • polyribonucleotide nucleotidyltransferase
    • general stress protein 13
    • S1 RNA-binding domain-containing protein
    • RNA-binding S1 domain-containing protein
    • putative S1 RNA binding domain
    • S1 RNA-binding domain protein
    • S1-type RNA-binding domain-containing protein
  • strand?: +
  • coordinates?: 3446835..3447212
  • synteny block?: BlockID0021650
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0910
    08BA02176:
    C248_0954
    11819-97:
    MS7_0910
    71193:
    ST398NM01_0938
    ECT-R 2:
    ECTR2_811
    ED133:
    SAOV_0901
    ED98:
    SAAV_0916
    HO 5096 0412:
    SAEMRSA15_07850
    JH1:
    SaurJH1_0974
    JH9:
    SaurJH9_0955
    JKD6008:
    SAA6008_00908
    JKD6159:
    SAA6159_00814
    LGA251:
    SARLGA251_08730
    M013:
    M013TW_0874
    MRSA252:
    SAR0917
    MSHR1132:
    SAMSHR1132_08070
    MSSA476:
    SAS0825
    Mu3:
    SAHV_0950
    Mu50:
    SAV0955
    MW2:
    MW0837
    RF122:
    SAB0822
    ST398:
    SAPIG0938
    T0131:
    SAT0131_00987
    TCH60:
    HMPREF0772_12291
    TW20:
    SATW20_09550
    USA300_TCH1516:
    VC40:
    SAVC_03950

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNYKIGQHIKVRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAK
    N315            ---------------------------------------MDDYVHNLKKFLSEGQIVKAK
    NCTC8325        -----------MRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAK
    Newman          MNNYKIGQHIKVRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAK
    USA300_FPR3757  -----------MRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAK
                                                           *********************

    COL             ILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKR
    N315            ILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKR
    NCTC8325        ILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKR
    Newman          ILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKR
    USA300_FPR3757  ILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKR
                    ************************************************************

    COL             AIRND
    N315            AIRND
    NCTC8325        AIRND
    Newman          AIRND
    USA300_FPR3757  AIRND
                    *****