From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01283
  • pan locus tag?: SAUPAN003623000
  • symbol: SAOUHSC_01283
  • pan gene symbol?: hflX
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01283
  • symbol: SAOUHSC_01283
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1239683..1240921
  • length: 1239
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGGCTCAGCAACAAATTCATGATACTAAAAATAAACTAGAAAAAGCTGTCTTAGTCGGT
    GTACATGCTCAAGATGATAAGCAATTTAATTTTGAGTCTACAATGGAGGAATTATCATCT
    TTATCAGAGACTTGCCAACTTGAAGTGTTGGGTCAAATTACTCAAAACAGAGATCGTGTA
    GATCGCAAATATTATGTTGGTAAAGGTAAAATTGAAGAAATTCAAGCATTTATTGAGTTC
    AAAGATATTGATGTAGTCATCACAAATGATGAATTAACGACTGCACAATCCAAATCACTA
    AATGAAGCTTTAGGTGTAAAAATTATTGATAGAACTCAGTTGATTCTTGAAATATTTGCA
    TTAAGAGCAAGAAGTAAAGAAGGTAAATTGCAAGTAGAGCTAGCACAACTTGATTATTTA
    TTACCTAGATTGCAAGGCCATGGTAAAAGCCTTTCTCGTTTAGGTGGCGGTATTGGAACT
    AGAGGCCCTGGTGAAACGAAGTTAGAGATGGATCGCAGACATATTCGAACTCGTATGAAT
    GAAATTAAACATCAATTGCGGACGGTAGAAGAACATCGCGAAAGATATCGAAATAAAAGA
    AATCAAAATCAGGTGTTTCAAGTAGCTTTAGTTGGTTATACAAATGCTGGTAAATCATCA
    TGGTTTAATGTTTTAGCAAATGAAGAGACGTATGAAAAAGATCAATTATTTGCAACGTTA
    GATCCTAAAACACGACAAATTCAAATAAATGATGGATTTAATTTAATTATTTCAGATACT
    GTTGGTTTTATACAGAAACTACCTACGACGTTAATTGCAGCTTTTAAATCAACTTTAGAA
    GAGGCTAAAGGTGCAGATTTATTAGTACATGTCGTAGATAGTAGCCATCCTGAATACCGT
    ACGCAGTATGACACAGTTAATGATTTAATCAAACAATTAGATATGAGTCATATTTCTCAA
    ATAGTTATTTTTAATAAAAAGGACTTATGTGATCATGCATCAAATCGTCCAGCAAGTGAT
    TTGCCTAATGTTTTTGTTTCTTCTAAAAATGATGGTGATAAATTACTTGTTAAGACGTTA
    TTTATTGATGAAATCAAAAGGCAATTAACTTATTATGATGAGACAATTGCGACGAATAAT
    GCAGATCGATTATATTTTCTAAAACAACATACATTAGTGACTGAACTTAAATATGATGAA
    ATTGAAAATGTTTATCGTATAAAAGGATTTAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1239

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01283
  • symbol: SAOUHSC_01283
  • description: hypothetical protein
  • length: 412
  • theoretical pI: 7.1298
  • theoretical MW: 47335.4
  • GRAVY: -0.551214

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralGTP-binding protein HflX (TIGR03156; HMM-score: 466.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 56.6)
    Genetic information processingProtein synthesisOtherribosome-associated GTPase EngA (TIGR03594; HMM-score: 45.5)
    Genetic information processingProtein synthesisOtherObg family GTPase CgtA (TIGR02729; HMM-score: 42.6)
    Genetic information processingProtein fateProtein modification and repair[FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 40.4)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 35.7)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 32.1)
    Genetic information processingProtein synthesisOtherGTP-binding protein Era (TIGR00436; HMM-score: 29.3)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 27.4)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 20.1)
    Unknown functionGeneralGTP-binding protein YchF (TIGR00092; HMM-score: 15.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 10.8)
  • TheSEED:  
    Hfl operon Ribosome LSU-associated GTP-binding protein HflX 
    Universal GTPases Ribosome LSU-associated GTP-binding protein HflX 
  • PFAM:
    no clan definedGTP-bdg_M; GTP-binding GTPase Middle Region (PF16360; HMM-score: 110.3)
    GTP-bdg_N; GTP-binding GTPase N-terminal (PF13167; HMM-score: 108.2)
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 66.7)
    Arf; ADP-ribosylation factor family (PF00025; HMM-score: 23.4)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 22.2)
    Gtr1_RagA; Gtr1/RagA G protein conserved region (PF04670; HMM-score: 22.1)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 21.7)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 19.2)
    Thioredoxin (CL0172) DUF4174; Domain of unknown function (DUF4174) (PF13778; HMM-score: 16.2)
    P-loop_NTPase (CL0023) SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 15.7)
    ABC_tran; ABC transporter (PF00005; HMM-score: 14.7)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 13.8)
    Chelatase (CL0043) ZnuA; Zinc-uptake complex component A periplasmic (PF01297; HMM-score: 13)
    no clan definedMMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 11
    • Cmax: 0.128
    • Cmax_pos: 24
    • Smax: 0.321
    • Smax_pos: 5
    • Smean: 0.224
    • D: 0.177
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVLGQITQNRDRVDRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFALRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMNEIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATLDPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYRTQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTLFIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]