From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003623000
  • symbol?: hflX
  • description?: GTPase HflX

      descriptions from strain specific annotations:

    • GTPase HflX
    • GTP-binding protein
    • putative GTP-binding protein
    • GTPase
    • GTP-binding protein, putative
    • GTP-binding proteinase modulator YnbA
    • GTP-binding protein HflX
    • GTP-binding protein HSR1-related
    • GTP-binding proten HflX
    • HSR1-like GTP-binding protein
  • strand?: +
  • coordinates?: 3960392..3961639
  • synteny block?: BlockID0026930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1263 (hflX)
    08BA02176:
    C248_1340
    11819-97:
    MS7_1263 (hflX)
    71193:
    ST398NM01_1308
    ECT-R 2:
    ECTR2_1163 (hflX)
    ED133:
    SAOV_1307
    ED98:
    SAAV_1280
    HO 5096 0412:
    SAEMRSA15_11400
    JH1:
    SaurJH1_1391
    JH9:
    SaurJH9_1365
    JKD6008:
    SAA6008_01260 (hflX)
    JKD6159:
    SAA6159_01160 (hflX)
    LGA251:
    SARLGA251_12160
    M013:
    M013TW_1247
    MRSA252:
    SAR1281
    MSHR1132:
    SAMSHR1132_11480
    MSSA476:
    SAS1239
    Mu3:
    SAHV_1296
    Mu50:
    SAV1307
    MW2:
    MW1189
    RF122:
    SAB1169
    ST398:
    SAPIG1308 (hflX)
    T0131:
    SAT0131_01362
    TCH60:
    HMPREF0772_11920 (hflX)
    TW20:
    SATW20_12990
    USA300_TCH1516:
    USA300HOU_1237
    VC40:
    SAVC_05725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVLGQITQNRDRV
    N315            MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVLGQITQNRDRV
    NCTC8325        MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVLGQITQNRDRV
    Newman          MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVWVQITQNRDRV
    USA300_FPR3757  MAQQQIHDTKNKLEKAVLVGVHAQDDKQFNFESTMEELSSLSETCQLEVLGQITQNRDRV
                    *************************************************  *********

    COL             DRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFA
    N315            DRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFA
    NCTC8325        DRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFA
    Newman          DRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFA
    USA300_FPR3757  DRKYYVGKGKIEEIQAFIEFKDIDVVITNDELTTAQSKSLNEALGVKIIDRTQLILEIFA
                    ************************************************************

    COL             LRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMN
    N315            LRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMN
    NCTC8325        LRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMN
    Newman          LRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMN
    USA300_FPR3757  LRARSKEGKLQVELAQLDYLLPRLQGHGKSLSRLGGGIGTRGPGETKLEMDRRHIRTRMN
                    ************************************************************

    COL             EIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATL
    N315            EIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATL
    NCTC8325        EIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATL
    Newman          EIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATL
    USA300_FPR3757  EIKHQLRTVEEHRERYRNKRNQNQVFQVALVGYTNAGKSSWFNVLANEETYEKDQLFATL
                    ************************************************************

    COL             DPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYR
    N315            DPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYR
    NCTC8325        DPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYR
    Newman          DPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYR
    USA300_FPR3757  DPKTRQIQINDGFNLIISDTVGFIQKLPTTLIAAFKSTLEEAKGADLLVHVVDSSHPEYR
                    ************************************************************

    COL             TQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTL
    N315            TQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTL
    NCTC8325        TQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTL
    Newman          TQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTL
    USA300_FPR3757  TQYDTVNDLIKQLDMSHISQIVIFNKKDLCDHASNRPASDLPNVFVSSKNDGDKLLVKTL
                    ************************************************************

    COL             FIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK
    N315            FIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK
    NCTC8325        FIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK
    Newman          FIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK
    USA300_FPR3757  FIDEIKRQLTYYDETIATNNADRLYFLKQHTLVTELKYDEIENVYRIKGFKK
                    ****************************************************