From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01502
  • pan locus tag?: SAUPAN003947000
  • symbol: SAOUHSC_01502
  • pan gene symbol?: recQ2
  • synonym:
  • product: ATP-dependent DNA helicase RecQ

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01502
  • symbol: SAOUHSC_01502
  • product: ATP-dependent DNA helicase RecQ
  • replicon: chromosome
  • strand: -
  • coordinates: 1455301..1456680
  • length: 1380
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    ATGTTGCATGATATTTTACGAAACAAATTTGGATTCGAGAGTTTTAAACCGGGACAACAG
    GAAATTATAGAAAGTATAATGTCTCAACAACACACTCTAGGTATACTTCCAACTGGAAGT
    GGAAAGAGTTTGTGTTATCAAATACCTACGTATTTATCAGGTAAGCCGACATTAATTATC
    TCACCGTTAATATCTTTAATGGATGACCAAGTTATGCAGTTGAAAATAAATGGAGAAAAA
    CGTGTAACATGTATTCACTCTGGTATGGATGAAATTGAGAAAAAGCATAATATTAAATGT
    TTACGACATAGCCGCTTCATCTTTCTAAGTCCAGAATTTCTCCTGCAACCGTCAAATTTT
    AAATTAATATCTATGATAGACTTTGGCATGATTGTTCTAGATGAAGCACATTGCCTATCT
    GAATGGGGATATGATTTCAGACCACATTATGCTCTAATAGGAAAAGTAACAAAGCATTTT
    AAAGAAGCGGTTGTCTTAGCATTGACAGCAACTGCACCACCGCATTTACAAGATGATTTG
    ACGGAAATGTTAGCGATTCAATTCAATGTTATTAAAACTACAATGAATCGCCCAAATATA
    AGCTTTAAGCATCTTAATTTTCATGATGATGAAGATAAAATTGAATGGTTGCTGCCGTTT
    CTACAACAGTCGGGACCAACGATTATTTATGTCTCATCGAAAAAGATGTGTCTGAATTTA
    GCGCAACTTATTTATGATTCAGGTTTTCTTACAGGTATTTATCATGGTGATATGAATTAT
    CAAGAGCGACACACAGTTCAACAACAATTTTTAAATAATGATATTCCGATTATAGTCGCA
    ACGAGTGCTTTTGGTATGGGAATTAATAAAAAAGATATTCGCACAATCATTCACTTTCAT
    CTTTCAACAAGTCCTTCTAACTACATTCAAGAAATTGGCCGTGCGGGTCGCGATGGTGAA
    CTAAGTCAGGCAATTAGTTTATTCCAACCGGACGATAAATATATTTTAGAAACGTTATTA
    TTTGCAGATATGATAACAGAAGAAGATGTACAAAATTTCGAAATAGGAGAATTTTTAGCT
    CCCGATAAACAAGCCGTTTTGACAACGTTGCAATCATTCTATAGTATCGGCGCCTTGAAA
    CAGATATTTAAGCAATCATTTAAACGAAAGCAATTAGGATTCTTTCGCATGATTGGCTAT
    TGCAAATTGGATCAATGTAGACGGAAGTATTTATTAGAATTTTTCGGTGAATATCCACCG
    GCACAAGATCGATGTTGTGACAATGATTCTAATATAACTGATATCGCAATTTTAAATAAG
    AAGAAGGTAATTAGAAGTATTGGATTTGATGAAAAGTTGCAAAATTTATTTCTCAGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01502
  • symbol: SAOUHSC_01502
  • description: ATP-dependent DNA helicase RecQ
  • length: 459
  • theoretical pI: 7.04867
  • theoretical MW: 52730.7
  • GRAVY: -0.163617

Function[edit source | edit]

  • reaction:
    EC 3.6.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairATP-dependent DNA helicase RecQ (TIGR01389; EC 3.6.4.12; HMM-score: 346.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairATP-dependent DNA helicase, RecQ family (TIGR00614; EC 3.6.4.12; HMM-score: 339)
    DEXH box helicase, DNA ligase-associated (TIGR04121; EC 3.6.4.-; HMM-score: 44.4)
    helicase/secretion neighborhood putative DEAH-box helicase (TIGR03817; HMM-score: 29.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairreverse gyrase (TIGR01054; EC 3.6.4.12,5.99.1.3; HMM-score: 22.5)
    DNA phosphorothioation system restriction enzyme (TIGR04095; HMM-score: 17.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairATP-dependent DNA helicase RecG (TIGR00643; EC 3.6.4.12; HMM-score: 16.9)
    CRISPR-associated helicase Cas3, subtype CYANO (TIGR03158; HMM-score: 13.8)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairtranscription-repair coupling factor (TIGR00580; EC 3.6.1.-; HMM-score: 13.3)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 12.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairputative DnaQ family exonuclease/DinG family helicase (TIGR01407; HMM-score: 12.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 11.9)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial RecFOR pathway ATP-dependent DNA helicase, RecQ family 
  • PFAM:
    P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 84.6)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 72)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 32.1)
    no clan definedRecQ_Zn_bind; RecQ zinc-binding (PF16124; HMM-score: 31.4)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.107
    • Ymax_pos: 70
    • Cmax: 0.107
    • Cmax_pos: 55
    • Smax: 0.148
    • Smax_pos: 1
    • Smean: 0.093
    • D: 0.101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLHDILRNKFGFESFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLIISPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLRHSRFIFLSPEFLLQPSNFKLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDLTEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNLAQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFHLSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLAPDKQAVLTTLQSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPPAQDRCCDNDSNITDIAILNKKKVIRSIGFDEKLQNLFLR

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]