From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003947000
  • symbol?: recQ2
  • description?: ATP-dependent DNA helicase RecQ

      descriptions from strain specific annotations:

    • ATP-dependent DNA helicase RecQ
    • ATP-dependent DNA helicase, RecQ family protein
    • ATP-dependent helicase RecQ
    • DEAD/DEAH box helicase
    • dead/deah box helicase family protein
    • RecQ familyATP-dependent DNA helicase
  • strand?: -
  • coordinates?: 4263071..4264450
  • synteny block?: BlockID0029930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1523 (recQ2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1438 (recQ)
    08BA02176:
    C248_1522
    11819-97:
    MS7_1435
    71193:
    ST398NM01_1481
    ECT-R 2:
    ECTR2_1333
    ED133:
    SAOV_1488
    ED98:
    SAAV_1469 (recQ2)
    HO 5096 0412:
    SAEMRSA15_13410
    JH1:
    SaurJH1_1569
    JH9:
    SaurJH9_1538
    JKD6008:
    SAA6008_01450 (recQ)
    JKD6159:
    SAA6159_01345 (recQ)
    LGA251:
    SARLGA251_13940
    M013:
    M013TW_1429
    MRSA252:
    SAR1490
    MSHR1132:
    SAMSHR1132_13200
    MSSA476:
    SAS1422
    Mu3:
    SAHV_1470
    Mu50:
    SAV1482
    MW2:
    MW1370
    RF122:
    SAB1344c
    ST398:
    SAPIG1481
    T0131:
    SAT0131_01571 (lpl1nm)
    TCH60:
    HMPREF0772_11724 (recQ)
    TW20:
    SATW20_14790
    USA300_TCH1516:
    USA300HOU_1420 (recQ2)
    VC40:
    SAVC_06655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLHDILRNKFGFESFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLII
    N315            MLHDILRNKFGFENFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLII
    NCTC8325        MLHDILRNKFGFESFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLII
    Newman          MLHDILRNKFGFESFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLII
    USA300_FPR3757  MLHDILRNKFGFESFKPGQQEIIESIMSQQHTLGILPTGSGKSLCYQIPTYLSGKPTLII
                    *************.**********************************************

    COL             SPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLRHSRFIFLSPEFLLQPSNF
    N315            SPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLLHSRFIFLSPEFLLQPSNF
    NCTC8325        SPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLRHSRFIFLSPEFLLQPSNF
    Newman          SPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLRHSRFIFLSPEFLLQPSNF
    USA300_FPR3757  SPLISLMDDQVMQLKINGEKRVTCIHSGMDEIEKKHNIKCLRHSRFIFLSPEFLLQPSNF
                    ***************************************** ******************

    COL             KLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDL
    N315            KLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDL
    NCTC8325        KLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDL
    Newman          KLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDL
    USA300_FPR3757  KLISMIDFGMIVLDEAHCLSEWGYDFRPHYALIGKVTKHFKEAVVLALTATAPPHLQDDL
                    ************************************************************

    COL             TEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNL
    N315            TEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNL
    NCTC8325        TEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNL
    Newman          TEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNL
    USA300_FPR3757  TEMLAIQFNVIKTTMNRPNISFKHLNFHDDEDKIEWLLPFLQQSGPTIIYVSSKKMCLNL
                    ************************************************************

    COL             AQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFH
    N315            AQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFH
    NCTC8325        AQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFH
    Newman          AQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFH
    USA300_FPR3757  AQLIYDSGFLTGIYHGDMNYQERHTVQQQFLNNDIPIIVATSAFGMGINKKDIRTIIHFH
                    ************************************************************

    COL             LSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLA
    N315            LSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLA
    NCTC8325        LSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLA
    Newman          LSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLA
    USA300_FPR3757  LSTSPSNYIQEIGRAGRDGELSQAISLFQPDDKYILETLLFADMITEEDVQNFEIGEFLA
                    ************************************************************

    COL             PDKQAVLTTLQSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPP
    N315            PDKQDVLTTLHSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPP
    NCTC8325        PDKQAVLTTLQSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPP
    Newman          PDKQAVLTTLQSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPP
    USA300_FPR3757  PDKQAVLTTLQSFYSIGALKQIFKQSFKRKQLGFFRMIGYCKLDQCRRKYLLEFFGEYPP
                    **** *****:*************************************************

    COL             AQDRCCDNDSNITDIAILNKKKVIRSIGFDEKLQNLFLR
    N315            AQDRCCDNDSNITDIVILNKKKVIRSIGFDEKLQNLFLR
    NCTC8325        AQDRCCDNDSNITDIAILNKKKVIRSIGFDEKLQNLFLR
    Newman          AQDRCCDNDSNITDIAILNKKKVIRSIGFDEKLQNLFLR
    USA300_FPR3757  AQDRCCDNDSNITDIAILNKKKVIRSIGFDEKLQNLFLR
                    ***************.***********************