From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01897
  • pan locus tag?: SAUPAN004470000
  • symbol: SAOUHSC_01897
  • pan gene symbol?: sigS
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01897
  • symbol: SAOUHSC_01897
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1808335..1808805
  • length: 471
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAAATTTAATGACGTATACAACAAACACCAGAAAATCATACACTATCTTTTAAAAAAA
    TATAATATTAGCTATAATTATGATGAGTATTATCAACTACTCTTGATAAAAATGTGGCAA
    TTGAGTCAGATATATAAACCCTCAAGCAAGCAATCTTTATCCTCTTTTTTATTCACTCGA
    TTAAATTTTTACCTTATCGATTTATTCAGACAACAAAATCAATTAAAAGATGTCATTTTA
    TGTGAGAATAATTCACCAACATTAACTGAACAACCAACATACTTTAATGAACATGACCTT
    CGTTTACAAGATATCTTCAAGCTTTTAAATCAAAGAGAAAGACTATGGCTCAAACTATAC
    CTTGAAGGATACAAGCAATTTGAAATTGCTGAAATCATGTCATTATCGCTTTCAACGATT
    AAATTAATTAAGATGTCCGTTAAGCGTAAATGCCAACATAATTTTAATTAG
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01897
  • symbol: SAOUHSC_01897
  • description: hypothetical protein
  • length: 156
  • theoretical pI: 9.76636
  • theoretical MW: 19153.2
  • GRAVY: -0.469231

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 60.9)
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 28.8)
    RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 28)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 22.3)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 21.8)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.6)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 15)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 14.9)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-G factor (TIGR02850; HMM-score: 12.4)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 12.1)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 11.9)
  • TheSEED:  
    RNA polymerase sigma factor SigS 
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 28.7)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 24.3)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 20.1)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.4)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.4)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 12
    • Cmax: 0.115
    • Cmax_pos: 51
    • Smax: 0.197
    • Smax_pos: 8
    • Smean: 0.138
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFNDVYNKHQKIIHYLLKKYNISYNYDEYYQLLLIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTYFNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHNFN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]