From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004470000
  • symbol?: sigS
  • description?: RNA polymerase sigma factor SigS

      descriptions from strain specific annotations:

    • RNA polymerase sigma factor SigS
    • RNA polymerase sigma-70 family protein
    • DNA-binding protein
    • DNA-directed RNA polymerase sigma subunit RpoE
    • ECF subfamily RNA polymerase sigma-24 factor
    • igma-70 family RNA polymerase sigma factor
    • putative DNA-binding protein
    • RNA polymerase, sigma-24 subunit, ECF subfamily
    • RNA Polymerase Binding Factor sigS
    • RNA polymerase factor sigma-70
    • RNA polymerase sigma-70
  • strand?: +
  • coordinates?: 4715003..4715949
  • synteny block?: BlockID0034660
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1732
    08BA02176:
    C248_1822 (sigS)
    11819-97:
    MS7_1779 (sigS)
    71193:
    ST398NM01_1827
    ECT-R 2:
    ECTR2_1613
    ED133:
    SAOV_1761
    ED98:
    SAAV_1787
    HO 5096 0412:
    SAEMRSA15_16860
    JH1:
    SaurJH1_1864
    JH9:
    SaurJH9_1829
    JKD6008:
    JKD6159:
    SAA6159_01698
    LGA251:
    SARLGA251_16640
    M013:
    MRSA252:
    SAR1859
    MSHR1132:
    SAMSHR1132_16240
    MSSA476:
    SAS1700
    Mu3:
    SAHV_1762
    Mu50:
    SAV1777
    MW2:
    MW1717
    RF122:
    SAB1635
    ST398:
    SAPIG1827
    T0131:
    SAT0131_01892
    TCH60:
    HMPREF0772_11378
    TW20:
    SATW20_17670
    USA300_TCH1516:
    USA300HOU_1766 (rpoE1)
    VC40:
    SAVC_08100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------------MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLL
    N315            --------------------------MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLL
    NCTC8325        --------------------------MKFNDVYNKHQKIIHYLLKKYNISYNYDEYYQLL
    Newman          --------------------------MKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLL
    USA300_FPR3757  MNDFSKYFILTLSGNICYTYNLENDYLKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLL
                                              :*********:****:******************

    COL             LIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTY
    N315            LIKMWQLSQIYKPSSKQSLSSFLFTRLNYYLIDLFRQQNQLKDVILCENNSPTLTEQPTY
    NCTC8325        LIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTY
    Newman          LIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTY
    USA300_FPR3757  LIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTY
                    ****************************:*******************************

    COL             FNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHN
    N315            FNEHDLRLQDIFKLLNHRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHN
    NCTC8325        FNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHN
    Newman          FNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHN
    USA300_FPR3757  FNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHN
                    ****************:*******************************************

    COL             FN
    N315            FN
    NCTC8325        FN
    Newman          FN
    USA300_FPR3757  FN
                    **