From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1722 [new locus tag: SAUSA300_RS09405 ]
  • pan locus tag?: SAUPAN004470000
  • symbol: SAUSA300_1722
  • pan gene symbol?: sigS
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1722 [new locus tag: SAUSA300_RS09405 ]
  • symbol: SAUSA300_1722
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1904566..1905114
  • length: 549
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATGATTTTTCTAAATATTTTATTCTAACTTTATCCGGAAATATTTGTTATACGTAT
    AACTTGGAGAATGACTACTTGAAATTTAATGACGTATACAACAAACACCACAAAATCATA
    CACCATCTTTTAAAAAAATATAATATTAGCTATAATTATGATGAGTATTATCAACTACTC
    TTGATAAAAATGTGGCAATTGAGTCAGATATATAAACCCTCAAGCAAGCAATCTTTATCC
    TCTTTTTTATTCACTCGATTAAATTTTTACCTTATCGATTTATTCAGACAACAAAATCAA
    TTAAAAGATGTCATTTTATGTGAGAATAATTCACCAACATTAACTGAACAACCAACATAC
    TTTAATGAACATGACCTTCGTTTACAAGATATCTTCAAGCTTTTAAATCAAAGAGAAAGA
    CTATGGCTCAAACTATACCTTGAAGGATACAAGCAATTTGAAATTGCTGAAATCATGTCA
    TTATCGCTTTCAACGATTAAATTAATTAAGATGTCCGTTAAGCGTAAATGCCAACATAAT
    TTTAATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1722 [new locus tag: SAUSA300_RS09405 ]
  • symbol: SAUSA300_1722
  • description: hypothetical protein
  • length: 182
  • theoretical pI: 9.30145
  • theoretical MW: 22242.6
  • GRAVY: -0.436813

Function[edit source | edit]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 60.4)
    and 8 more
    transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 28.5)
    RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 25.1)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 23)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 21.8)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.7)
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 14.5)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 11.4)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 11.3)
  • TheSEED:  
    RNA polymerase sigma factor SigS 
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 28.5)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 23.9)
    and 6 more
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 19.6)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.1)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12.7)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 12.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 11.6)
    no clan definedDUF3837; Domain of unknown function (DUF3837) (PF12939; HMM-score: 7.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.12
    • Ymax_pos: 30
    • Cmax: 0.116
    • Cmax_pos: 22
    • Smax: 0.249
    • Smax_pos: 1
    • Smean: 0.116
    • D: 0.118
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNDFSKYFILTLSGNICYTYNLENDYLKFNDVYNKHHKIIHHLLKKYNISYNYDEYYQLLLIKMWQLSQIYKPSSKQSLSSFLFTRLNFYLIDLFRQQNQLKDVILCENNSPTLTEQPTYFNEHDLRLQDIFKLLNQRERLWLKLYLEGYKQFEIAEIMSLSLSTIKLIKMSVKRKCQHNFN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_1722 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]