From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01954
  • pan locus tag?: SAUPAN004583000
  • symbol: SAOUHSC_01954
  • pan gene symbol?: lukD
  • synonym:
  • product: leukotoxin LukD

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01954
  • symbol: SAOUHSC_01954
  • product: leukotoxin LukD
  • replicon: chromosome
  • strand: -
  • coordinates: 1859010..1859993
  • length: 984
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAAAATGAAAAAATTAGTCAAATCATCAGTTGCTTCATCAATTGCACTGCTTTTGCTA
    TCGAATACAGTTGATGCAGCTCAACATATCACACCTGTAAGCGAGAAAAAAGTAGATGAC
    AAAATCACTTTATACAAAACAACAGCAACATCTGATAATGATAAATTGAATATTTCTCAA
    ATTTTAACGTTTAATTTCATTAAGGATAAAAGTTATGACAAAGATACGTTAGTACTTAAG
    GCAGCCGGAAACATTAATTCAGGTTATAAAAAGCCTAATCCAAAAGATTACAATTACTCA
    CAGTTTTATTGGGGCGGTAAGTATAATGTTTCGGTTAGTTCAGAATCAAATGATGCTGTA
    AATGTTGTTGACTATGCACCTAAAAATCAAAATGAAGAATTCCAAGTTCAACAAACATTA
    GGTTATTCTTATGGCGGAGATATTAATATATCTAATGGCTTATCAGGTGGATTAAATGGA
    TCAAAATCATTTTCAGAAACGATAAATTATAAACAAGAAAGTTACAGAACTACGATTGAT
    AGAAAAACAAATCATAAATCAATTGGCTGGGGTGTTGAGGCGCACAAAATTATGAATAAT
    GGTTGGGGACCATATGGTAGAGATAGTTATGACCCAACATATGGTAATGAACTGTTTTTA
    GGTGGTAGACAAAGTAGTTCAAATGCTGGTCAAAATTTCTTGCCAACACATCAAATGCCT
    TTATTGGCGCGTGGTAACTTTAACCCAGAATTTATAAGCGTACTTTCTCATAAACAAAAT
    GATACAAAAAAATCTAAAATCAAAGTAACTTACCAAAGAGAAATGGATAGATATACTAAT
    CAATGGAATCGACTACACTGGGTTGGAAATAACTACAAAAATCAAAATACAGTAACGTTT
    ACATCTACTTATGAAGTTGACTGGCAAAACCATACTGTTAAATTAATCGGTACGGATTCT
    AAAGAAACTAATCCTGGAGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    984

Protein[edit source | edit]

Protein Data Bank: 4Q7G

General[edit source | edit]

  • locus tag: SAOUHSC_01954
  • symbol: SAOUHSC_01954
  • description: leukotoxin LukD
  • length: 327
  • theoretical pI: 9.65379
  • theoretical MW: 36888.7
  • GRAVY: -0.815596

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistancebeta-channel forming cytolysin (TIGR01002; HMM-score: 441.5)
  • TheSEED:  
    Virulence, Disease and DefenseToxins and superantigensStaphylococcus Two-component and Pore-forming Cytolysins Leukotoxin LukD 
  • PFAM:
    Leukocidin (CL0636) Leukocidin; Leukocidin/Hemolysin toxin family (PF07968; HMM-score: 296.9)
    no clan definedtRNA_synt_1c_R2; Glutaminyl-tRNA synthetase, non-specific RNA binding region part 2 (PF04557; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: NTVDAAQH
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.645
    • Ymax_pos: 27
    • Cmax: 0.446
    • Cmax_pos: 27
    • Smax: 0.969
    • Smax_pos: 8
    • Smean: 0.943
    • D: 0.761
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAVNVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTIDRKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMPLLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWVGNNYKNQNTVTFTSTYEVDWQNHTVKLIGTDSKETNPGV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SAOUHSC_00715 (SaeR*)
    SaeR* (TF) important in Virulence

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Naoko Morinaga, Yuriko Kaihou, Masatoshi Noda
Purification, cloning and characterization of variant LukE-LukD with strong leukocidal activity of staphylococcal bi-component leukotoxin family.
Microbiol. Immunol.: 2003, 47(1);81-90
[PubMed:12636257] [WorldCat.org] (P p)
Jun Kaneko, Yoshiyuki Kamio
Bacterial two-component and hetero-heptameric pore-forming cytolytic toxins: structures, pore-forming mechanism, and organization of the genes.
Biosci. Biotechnol. Biochem.: 2004, 68(5);981-1003
[PubMed:15170101] [WorldCat.org] [DOI] (P p)