From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004583000
  • symbol?: lukD
  • description?: leukotoxin, LukD

      descriptions from strain specific annotations:

    • leukotoxin, LukD
    • leukotoxin F-subunit
    • beta-channel forming cytolysin
    • leukotoxin LukD
    • leukocidin-F subunit (Gamma-hemolysin, H-gamma-I subunit)
    • leukocidin LukD precursor
    • gamma-hemolysin component B
    • gamma-hemolysin component B precursor
    • lukF-PV
    • leukotoxin D subunit
  • strand?: -
  • coordinates?: 4816411..4829614
  • synteny block?: BlockID0035640
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1880 (lukD)
    N315:
    SA1637 (lukD)
    NCTC8325:
    Newman:
    NWMN_1718 (lukD)
    USA300_FPR3757:
    04-02981:
    SA2981_1774 (lukD)
    08BA02176:
    11819-97:
    MS7_1824
    71193:
    ECT-R 2:
    ECTR2_1652
    ED133:
    SAOV_1812 (lukD)
    ED98:
    SAAV_1828 (lukD)
    HO 5096 0412:
    JH1:
    SaurJH1_1904
    JH9:
    SaurJH9_1870
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_17080 (hlgB)
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1748 (hlgB)
    Mu3:
    SAHV_1804 (lukD)
    Mu50:
    SAV1819 (lukD)
    MW2:
    MW1767 (lukD)
    RF122:
    SAB1686c (lukD)
    ST398:
    T0131:
    SAT0131_01946
    TCH60:
    TW20:
    SATW20_18210 (hlgB)
    USA300_TCH1516:
    USA300HOU_1817 (lukD)
    VC40:
    SAVC_08360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQ
    N315            MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQ
    NCTC8325        MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQ
    Newman          MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQ
    USA300_FPR3757  MKMKKLVKSSVASSIALLLLSNTVDAAQHITPVSEKKVDDKITLYKTTATSDNDKLNISQ
                    ************************************************************

    COL             ILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAV
    N315            ILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAV
    NCTC8325        ILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAV
    Newman          ILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAV
    USA300_FPR3757  ILTFNFIKDKSYDKDTLVLKAAGNINSGYKKPNPKDYNYSQFYWGGKYNVSVSSESNDAV
                    ************************************************************

    COL             NVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTID
    N315            NVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTID
    NCTC8325        NVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTID
    Newman          NVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTID
    USA300_FPR3757  NVVDYAPKNQNEEFQVQQTLGYSYGGDINISNGLSGGLNGSKSFSETINYKQESYRTTID
                    ************************************************************

    COL             RKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMP
    N315            RKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMP
    NCTC8325        RKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMP
    Newman          RKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMP
    USA300_FPR3757  RKTNHKSIGWGVEAHKIMNNGWGPYGRDSYDPTYGNELFLGGRQSSSNAGQNFLPTHQMP
                    ************************************************************

    COL             LLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWVGNNYKNQNTVTF
    N315            LLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWIGNNYKNQNTVTF
    NCTC8325        LLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWVGNNYKNQNTVTF
    Newman          LLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWVGNNYKNQNTVTF
    USA300_FPR3757  LLARGNFNPEFISVLSHKQNDTKKSKIKVTYQREMDRYTNQWNRLHWVGNNYKNQNTVTF
                    ***********************************************:************

    COL             TSTYEVDWQNHTVKLIGTDSKETNPGV
    N315            TSTYEVDWQNHTVKLIGTDSKETNPGV
    NCTC8325        TSTYEVDWQNHTVKLIGTDSKETNPGV
    Newman          TSTYEVDWQNHTVKLIGTDSKETNPGV
    USA300_FPR3757  TSTYEVDWQNHTVKLIGTDSKETNPGV
                    ***************************