From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02766
  • pan locus tag?: SAUPAN006026000
  • symbol: SAOUHSC_02766
  • pan gene symbol?: cntB
  • synonym:
  • product: peptide ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_02766
  • symbol: SAOUHSC_02766
  • product: peptide ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2541909..2542844
  • length: 936
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGTTCAAATTTATCTTAAAACGTATTGCGCTCATGTTTCCATTGATGATTGTAGTAAGT
    TTTATGACATTTCTATTGACGTATATTACAAATGAAAATCCAGCTGTGACAATTTTACAT
    GCACAAGGGACGCCAAATGTAACACCAGAGTTGATTGCAGAAACGAATGAGAAGTACGGT
    TTCAATGATCCATTATTAATTCAATATAAAAATTGGTTACTTGAAGCGATGCAATTTAAT
    TTTGGTACAAGCTACATTACAGGTGACCCAGTTGCTGAACGTATTGGTCCAGCATTTATG
    AATACATTGAAATTAACAATAATTTCAAGTGTTATGGTGATGATTACATCAATTATTTTA
    GGTGTAGTTAGTGCATTAAAAAGAGGAAAGTTCACTGATCGTGCGATACGTTCAGTGGCT
    TTCTTTCTAACTGCATTACCATCATATTGGATAGCTTCAATACTTATTATTTACGTTTCA
    GTGAAGTTAAACATATTGCCGACTTCTGGATTAACAGGTCCAGAAAGTTACATATTGCCA
    GTGATCGTTATTACGATTGCCTATGCTGGTATTTACTTTAGAAATGTTAGACGCTCGATG
    GTGGAACAATTAAATGAAGATTATGTACTTTATTTAAGAGCAAGCGGTGTGAAATCTATC
    ACATTAATGTTGCATGTGTTGCGTAATGCTTTACAAGTTGCGGTATCAATCTTTTGTATG
    TCTATACCAATGATAATGGGTGGACTAGTTGTTATCGAGTATATCTTTGCATGGCCTGGA
    CTAGGTCAATTAAGTTTAAAAGCAATACTTGAACACGATTTTCCAGTCATTCAAGCATAT
    GTATTAATTGTAGCGGTATTATTTATTGTATTTAATACATTAGCAGATATCATTAATGCG
    CTATTAAATCCAAGATTAAGGGAGGGCGCACGATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    936

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_02766
  • symbol: SAOUHSC_02766
  • description: peptide ABC transporter permease
  • length: 311
  • theoretical pI: 9.51657
  • theoretical MW: 34780.4
  • GRAVY: 0.746302

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel ABC transporter, permease subunit NikB (TIGR02789; EC 3.6.3.24; HMM-score: 284.4)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 11.2)
  • TheSEED:  
    Oligopeptide transporter putative membrane permease domain 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 140.8)
    no clan definedDUF4133; Domain of unknown function (DUF4133) (PF13571; HMM-score: 9.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 12 aa
    • Ymax: 0.272
    • Ymax_pos: 12
    • Cmax: 0.166
    • Cmax_pos: 36
    • Smax: 0.826
    • Smax_pos: 8
    • Smean: 0.766
    • D: 0.465
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYGFNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIILGVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILPVIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINALLNPRLREGAR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]

Laetitia Remy, Marie Carrière, Aurélie Derré-Bobillot, Cécilia Martini, Maurizio Sanguinetti, Elise Borezée-Durant
The Staphylococcus aureus Opp1 ABC transporter imports nickel and cobalt in zinc-depleted conditions and contributes to virulence.
Mol. Microbiol.: 2013, 87(4);730-43
[PubMed:23279021] [WorldCat.org] [DOI] (I p)