From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006026000
  • symbol?: cntB
  • description?: oligopeptide transporter permease

      descriptions from strain specific annotations:

    • oligopeptide transporter permease
    • binding-protein-dependent transport systems inner membrane component
    • Oligopeptide transporter putative membrane permease domain protein
    • binding-protein-dependent transport system inner membrane component family protein
    • peptide ABC transporter permease
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • oligopeptide ABC transporter permease
    • oligopeptide transporter putative membrane permease
    • oligopeptide ABC transporter membrane protein
    • oligopeptide transporter membrane permease Opp-1B
    • binding--dependent transport system inner membrane component family protein
    • opp-1B protein
    • nickel transport system permease protein
  • strand?: -
  • coordinates?: 6082254..6083189
  • synteny block?: BlockID0047700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2254 (opp-1B)
    NCTC8325:
    Newman:
    NWMN_2363 (opp1B)
    USA300_FPR3757:
    04-02981:
    SA2981_2403 (opp-1B)
    08BA02176:
    C248_2516 (opp-1B)
    11819-97:
    MS7_2479
    71193:
    ST398NM01_2516
    ECT-R 2:
    ECTR2_2323
    ED133:
    SAOV_2516c
    ED98:
    SAAV_2532
    HO 5096 0412:
    SAEMRSA15_23640 (opp-1B)
    JH1:
    SaurJH1_2542
    JH9:
    SaurJH9_2493
    JKD6008:
    SAA6008_02507 (opp-1B)
    JKD6159:
    SAA6159_02363 (opp-1B)
    LGA251:
    SARLGA251_22460 (opp-1B)
    M013:
    M013TW_2426
    MRSA252:
    SAR2553 (opp-1B)
    MSHR1132:
    SAMSHR1132_22910
    MSSA476:
    SAS2357
    Mu3:
    SAHV_2450
    Mu50:
    SAV2466
    MW2:
    MW2390 (opp-1B)
    RF122:
    SAB2349c (opp1B)
    ST398:
    SAPIG2516
    T0131:
    SAT0131_02665
    TCH60:
    HMPREF0772_10723 (opp-1B)
    TW20:
    SATW20_25940 (opp-1B)
    USA300_TCH1516:
    USA300HOU_2457
    VC40:
    SAVC_11200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQRTPNVTPELIAETNEKYG
    N315            MFKFILKRIALMFPLVIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYG
    NCTC8325        MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYG
    Newman          MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYG
    USA300_FPR3757  MFKFILKRIALMFPLMIVVSFMTFLLTYITNENPAVTILHAQGTPNVTPELIAETNEKYG
                    ***************:************************** *****************

    COL             FNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIIL
    N315            FNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIIL
    NCTC8325        FNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIIL
    Newman          FNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIIL
    USA300_FPR3757  FNDPLLIQYKNWLLEAMQFNFGTSYITGDPVAERIGPAFMNTLKLTIISSVMVMITSIIL
                    ************************************************************

    COL             GVVSALKRGKFTDRAIRSVAFVLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILP
    N315            GVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILP
    NCTC8325        GVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILP
    Newman          GVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILP
    USA300_FPR3757  GVVSALKRGKFTDRAIRSVAFFLTALPSYWIASILIIYVSVKLNILPTSGLTGPESYILP
                    *********************.**************************************

    COL             VIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCM
    N315            VIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNAIQVAVSIFCM
    NCTC8325        VIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCM
    Newman          VIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCM
    USA300_FPR3757  VIVITIAYAGIYFRNVRRSMVEQLNEDYVLYLRASGVKSITLMLHVLRNALQVAVSIFCM
                    **************************************************:*********

    COL             SIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINA
    N315            SIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINA
    NCTC8325        SIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINA
    Newman          SIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINA
    USA300_FPR3757  SIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPVIQAYVLIVAVLFIVFNTLADIINA
                    ************************************************************

    COL             LLNPRLREGAR
    N315            LLNPRLREGAR
    NCTC8325        LLNPRLREGAR
    Newman          LLNPRLREGAR
    USA300_FPR3757  LLNPRLREGAR
                    ***********