From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: agrD
  • pan gene symbol?: agrD
  • synonym:
  • product: AgrD protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • symbol: agrD
  • product: AgrD protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2080012..2080155
  • length: 144
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAATACACTTGTTAATATGTTTTTTGATTTTATAATTAAATTAGCTAAAGCAATCGGA
    ATTGTCGGTGGCGTAAACGCTTGCAGCAGTTTATTTGATGAACCTAAAGTACCCGCTGAA
    TTAACGAATTTATACGACAAATAG
    60
    120
    144

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • symbol: AgrD
  • description: AgrD protein
  • length: 47
  • theoretical pI: 4.63622
  • theoretical MW: 5149.04
  • GRAVY: 0.482979

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 35.2)
  • TheSEED:  
    Accessory gene regulator D (pheromone precursor, type III) 
  • PFAM:
    no clan definedAgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 52.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.269
    • Ymax_pos: 28
    • Cmax: 0.183
    • Cmax_pos: 28
    • Smax: 0.513
    • Smax_pos: 13
    • Smean: 0.368
    • D: 0.307
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927612 NCBI
  • RefSeq: NP_375145 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: AgrA, CodY
    AgrA (TF) important in Quorum sensing, Virulence  RegPrecise
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]