From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005276000
  • symbol?: agrD
  • description?: cyclic lactone autoinducer peptide

      descriptions from strain specific annotations:

    • cyclic lactone autoinducer peptide
    • accessory gene regulator protein D
    • AgrD protein
    • staphylococcal accessory gene regulator protein D
    • Accessory gene regulator D (pheromone precursor, type II)
    • accessory gene regulator D (pheromone precursor, type III)
    • accessory gene regulator peptide AgrD
    • AgrD family protein
    • autoinducer peptide precursor
    • Regulator protein agrD
    • staphylococcal AgrD family protein
  • strand?: +
  • coordinates?: 5443472..5443613
  • synteny block?: BlockID0040770
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2024 (agrD)
    N315:
    SAS066 (agrD)
    NCTC8325:
    Newman:
    NWMN_1944 (agrD)
    USA300_FPR3757:
    04-02981:
    SA2981_1978 (agrD)
    08BA02176:
    C248_2041 (agrD)
    11819-97:
    71193:
    ST398NM01_2074
    ECT-R 2:
    ECTR2_1888
    ED133:
    SAOV_2074
    ED98:
    SAAV_2085 (agrD)
    HO 5096 0412:
    SAEMRSA15_19450 (agrD)
    JH1:
    JH9:
    SaurJH9_2074
    JKD6008:
    SAA6008_02075 (agrD)
    JKD6159:
    SAA6159_01950 (agrD)
    LGA251:
    SARLGA251_18390 (agrD)
    M013:
    M013TW_1989
    MRSA252:
    SAR2124 (agrD)
    MSHR1132:
    SAMSHR1132_18590
    MSSA476:
    SAS1942
    Mu3:
    SAHV_2022 (agrD)
    Mu50:
    SAV2037 (agrD)
    MW2:
    MW1961 (agrD)
    RF122:
    SAB1921 (agrD)
    ST398:
    SAPIG2074
    T0131:
    SAT0131_02184 (crtN)
    TCH60:
    HMPREF0772_11162 (agrD)
    TW20:
    SATW20_20200 (agrD)
    USA300_TCH1516:
    USA300HOU_2033 (agrD)
    VC40:
    SAVC_09065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE-
    N315            MNTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYDK
    NCTC8325        MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE-
    Newman          MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE-
    USA300_FPR3757  MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE-
                    ****.*:*****  : * ** :.. .:*. ::** :** ***:*::