From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000024000
  • symbol?:
  • description?: DHH family phosphoesterase

      descriptions from strain specific annotations:

    • DHH family phosphoesterase
    • putative bifunctional signaling protein/50S ribosomal protein L9
    • DHH subfamily 1 protein
    • DHH subfamily phosphodiesterase
    • DHH family protein
    • phosphoesterase, DHH family protein
    • phosphoesterase domain-containing protein
    • DHHA1 domain protein
  • strand?: +
  • coordinates?: 24265..26250
  • synteny block?: BlockID0000210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0014
    08BA02176:
    C248_0014
    11819-97:
    MS7_0014
    71193:
    ST398NM01_0014
    ECT-R 2:
    ECTR2_14
    ED133:
    SAOV_0014
    ED98:
    SAAV_0016
    HO 5096 0412:
    SAEMRSA15_00140
    JH1:
    SaurJH1_0014
    JH9:
    SaurJH9_0014
    JKD6008:
    SAA6008_00014
    JKD6159:
    SAA6159_00014
    LGA251:
    SARLGA251_00140
    M013:
    M013TW_0015
    MRSA252:
    SAR0014
    MSHR1132:
    SAMSHR1132_00140
    MSSA476:
    SAS0014
    Mu3:
    SAHV_0014
    Mu50:
    SAV0014
    MW2:
    MW0014
    RF122:
    SAB0014
    ST398:
    SAPIG0014
    T0131:
    SAT0131_00016
    TCH60:
    HMPREF0772_10454
    TW20:
    SATW20_00140
    USA300_TCH1516:
    USA300HOU_0014
    VC40:
    SAVC_00070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMK
    N315            MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMK
    NCTC8325        MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMK
    Newman          MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMK
    USA300_FPR3757  MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMK
                    ************************************************************

    COL             MDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVF
    N315            MDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTNHMEANVISESVNEVF
    NCTC8325        MDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVF
    Newman          MDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVF
    USA300_FPR3757  MDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVF
                    ********************************************:***************

    COL             PNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFL
    N315            PNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFL
    NCTC8325        PNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFL
    Newman          PNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFL
    USA300_FPR3757  PNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFL
                    ************************************************************

    COL             DNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEES
    N315            DNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEES
    NCTC8325        DNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEES
    Newman          DNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEES
    USA300_FPR3757  DNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEES
                    ************************************************************

    COL             KFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSIN
    N315            KFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSIN
    NCTC8325        KFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSIN
    Newman          KFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSIN
    USA300_FPR3757  KFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSIN
                    ************************************************************

    COL             GNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRF
    N315            GNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRF
    NCTC8325        GNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRF
    Newman          GNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRF
    USA300_FPR3757  GNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRF
                    ************************************************************

    COL             AMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTH
    N315            AMMNNLEAYIVLNETDIDPTLRRVMNEIDKKSELRERFITSDDAWDMMTSKTTVVIVDTH
    NCTC8325        AMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTH
    Newman          AMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTH
    USA300_FPR3757  AMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTH
                    *******************************.****************************

    COL             KPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQ
    N315            KPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQ
    NCTC8325        KPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQ
    Newman          KPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQ
    USA300_FPR3757  KPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQ
                    ************************************************************

    COL             RLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINR
    N315            RLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINR
    NCTC8325        RLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINR
    Newman          RLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINR
    USA300_FPR3757  RLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINR
                    ************************************************************

    COL             SELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGIS
    N315            SELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGIS
    NCTC8325        SELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGIS
    Newman          SELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGIS
    USA300_FPR3757  SELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGIS
                    ************************************************************

    COL             ARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
    N315            ARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
    NCTC8325        ARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
    Newman          ARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
    USA300_FPR3757  ARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
                    *******************************************************