From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000911000
  • symbol?: sirC
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • transport system permease
    • Siderophore staphylobactin ABC transporter, permease protein SirC
    • fecCD transport family protein
    • iron compound ABC transporter, permease protein SirC
    • iron compound ABC transporter permease SirC
    • lipoprotein, SirC
    • siderophore compound ABC transporter permease SirC
    • iron (Fe3+) ABC transporter membrane protein
    • putative siderophore transport system permease protein yfhA
    • siderophore transport protein
    • Fe3+-siderophore ABC transporter permease
    • iron-dicitrate transporter subunit FecD
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • Iron compound ABC superfamily ATP binding cassette transporter, permease protein SirC
    • Staphylobactin transport system permease protein
  • strand?: -
  • coordinates?: 1179639..1180553
  • synteny block?: BlockID0004480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0097 (sirC)
    N315:
    SA0109 (sirC)
    NCTC8325:
    Newman:
    NWMN_0057 (sirC)
    USA300_FPR3757:
    04-02981:
    SA2981_0114 (sirC)
    08BA02176:
    C248_0101 (sirC)
    11819-97:
    MS7_0105 (yfhA)
    71193:
    ST398NM01_0124
    ECT-R 2:
    ECTR2_69
    ED133:
    SAOV_0060 (sirC)
    ED98:
    SAAV_0081 (sirC)
    HO 5096 0412:
    SAEMRSA15_00790 (sirC)
    JH1:
    SaurJH1_0104
    JH9:
    SaurJH9_0100
    JKD6008:
    SAA6008_00091 (fecD)
    JKD6159:
    SAA6159_00096 (fepD)
    LGA251:
    SARLGA251_00880 (sirC)
    M013:
    M013TW_0103
    MRSA252:
    SAR0116 (sirC)
    MSHR1132:
    SAMSHR1132_00890
    MSSA476:
    SAS0087
    Mu3:
    SAHV_0112 (sirC)
    Mu50:
    SAV0113 (sirC)
    MW2:
    MW0086 (sirC)
    RF122:
    SAB0052c (sirC)
    ST398:
    SAPIG0124
    T0131:
    SAT0131_00098
    TCH60:
    HMPREF0772_10384 (sirC)
    TW20:
    SATW20_01250 (sirC)
    USA300_TCH1516:
    USA300HOU_0124 (sirC)
    VC40:
    SAVC_00305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEKINKKDNYHLIFALIFLAIVSVVSMMIGSSFIPLQRVLMYFINPNDSMDQFTLEVLR
    N315            ---------------------------MMIGSSFIPLQRVLMYFINPNDSMDQFTLEVLR
    NCTC8325        ----------------------------MIGSSFIPLQRVLMYFINPNDSMDQFTLEVLR
    Newman          MTEKINKKDNYHLIFALIFLAIVSVVSMMIGSSFIPLQRVLMYFINPNDSMDQFTLEVLR
    USA300_FPR3757  MTEKINKKDNYHLIFALIFLAIVSVVSMMIGSSFIPLQRVLMYFINPNDSMDQFTLEVLR
                                                ********************************

    COL             LPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLSAVVFIAFFSHLTIHLL
    N315            LPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLSAVVFIAFFSHLTIHLL
    NCTC8325        LPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLSAVVFIAFFSHLTIHLL
    Newman          LPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLSAVVFIAFFSHLTIHLL
    USA300_FPR3757  LPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLSAVVFIAFFSHLTIHLL
                    ************************************************************

    COL             PLFAVLGGAVAMMILLVFQTKGQIRPTTLIIIGISMQTLFIALVQGLLITTKQLSAAKAY
    N315            PLFAVLGGAVAMMILLVFQTKGQIRPTILIIIGISMQTLFIALVQGLLITTKQLSAAKAY
    NCTC8325        PLFAVLGGAVAMMILLVFQTKGQIRPTTLIIIGISMQTLFIALVQGLLITTKQLSAAKAY
    Newman          PLFAVLGGAVAMMILLVFQTKGQIRPTTLIIIGISMQTLFIALVQGLLITTKQLSAAKAY
    USA300_FPR3757  PLFAVLGGAVAMMILLVFQTKGQIRPTTLIIIGISMQTLFIALVQGLLITTKQLSAAKAY
                    *************************** ********************************

    COL             TWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILDDPVAIGLGLHVQRMKLIQ
    N315            TWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILDDPVAIGLGLHVQRMKLIQ
    NCTC8325        TWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILDDPVAIGLGLHVQRMKLIQ
    Newman          TWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILDDPVAIGLGLHVQRMKLIQ
    USA300_FPR3757  TWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILDDPVAIGLGLHVQRMKLIQ
                    ************************************************************

    COL             LITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGAISIVIADLIGR
    N315            LITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGAISIVIADLIGR
    NCTC8325        LITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGAISIVIADLIGR
    Newman          LITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGAISIVIADLIGR
    USA300_FPR3757  LITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKLLMSAMIGAISIVIADLIGR
                    ************************************************************

    COL             TLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL
    N315            TLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL
    NCTC8325        TLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL
    Newman          TLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL
    USA300_FPR3757  TLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL
                    ********************************