From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000957000
  • symbol?: phnD
  • description?: alkylphosphonate ABC transporter

      descriptions from strain specific annotations:

    • alkylphosphonate ABC transporter
    • phosphonate ABC transporter, periplasmic phosphonate-binding protein
    • phosphonate ABC transporter periplasmic phosphonate-binding protein
    • phosphonate ABC transporter substrate-binding protein
    • Phosphonate ABC transporter phosphate-binding periplasmic component
    • phosphate/phosphite/phosphonate ABC transporters, periplasmic binding family protein
    • putative lipoprotein
    • transport protein
    • phosphonate ABC transporter phosphonate-binding protein
    • phosphate/phosphonate ABC transporter periplasmic protein
    • phosphonate ABC superfamily ATP binding cassette transporter, binding protein
    • phosphonate ABC transporter, phosphonate-binding protein
    • phosphonates-binding protein
    • ABC transporter ATP-binding protein
    • phosphate/phosphite/phosphonate ABC transporter, periplasmic binding family protein
  • strand?: -
  • coordinates?: 1216675..1217631
  • synteny block?: BlockID0004920
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0144
    08BA02176:
    C248_0132
    11819-97:
    MS7_0134 (phnD)
    71193:
    ST398NM01_0157
    ECT-R 2:
    ECTR2_99 (phnD)
    ED133:
    SAOV_0090
    ED98:
    SAAV_0111
    HO 5096 0412:
    SAEMRSA15_01090
    JH1:
    SaurJH1_0134
    JH9:
    SaurJH9_0129
    JKD6008:
    SAA6008_00121 (phnD)
    JKD6159:
    SAA6159_00126 (phnD)
    LGA251:
    SARLGA251_01170
    M013:
    M013TW_0133
    MRSA252:
    SAR0145
    MSHR1132:
    SAMSHR1132_01190
    MSSA476:
    SAS0117
    Mu3:
    SAHV_0142
    Mu50:
    SAV0143
    MW2:
    MW0117
    RF122:
    SAB0084c
    ST398:
    SAPIG0157
    T0131:
    SAT0131_00132
    TCH60:
    HMPREF0772_10355
    TW20:
    SATW20_01540
    USA300_TCH1516:
    USA300HOU_0155
    VC40:
    SAVC_00460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNFKCLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYKPKELTVQFVPSQNAG
    N315            MKNFKYLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYKPKELTVQFVPSQNAG
    NCTC8325        MKNFKCLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYKPKELTVQFVPSQNAG
    USA300_FPR3757  MKNFKCLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYKPKELTVQFVPSQNAG
                    ***** ******************************************************

    COL             TLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVGFLPPTAYTLAHDQKAA
    N315            TLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVGFLPPTAYTLAHDQKAA
    NCTC8325        TLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVGFLPPTAYTLAHDQKAA
    USA300_FPR3757  TLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVGFLPPTAYTLAHDQKAA
                    ************************************************************

    COL             DLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDLKGKKIALQDVTSTAGYT
    N315            DLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDLKGKKIALQDVTSTAGYT
    NCTC8325        DLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDLKGKKIALQDVTSTAGYT
    USA300_FPR3757  DLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDLKGKKIALQDVTSTAGYT
                    ************************************************************

    COL             FPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAAVFNDARNTVKKDQPNVFK
    N315            FPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAAVFNDARNTVKKDQPNVFK
    NCTC8325        FPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAAVFNDARNTVKKDQPNVFK
    USA300_FPR3757  FPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAAVFNDARNTVKKDQPNVFK
                    ************************************************************

    COL             DTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSKEGHKIISEVYSHEGYTETK
    N315            DTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSKEGHKIISEVYSHEGYTETK
    NCTC8325        DTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSKEGHKIISEVYSHEGYTETK
    USA300_FPR3757  DTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSKEGHKIISEVYSHEGYTETK
                    ************************************************************

    COL             DSNFDIVREYEKLVKDMK
    N315            DSNFDIVREYEKLVKDMK
    NCTC8325        DSNFDIVREYEKLVKDMK
    USA300_FPR3757  DSNFDIVREYEKLVKDMK
                    ******************