From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001077000
  • symbol?: hptS
  • description?: sensor histidine kinase

      descriptions from strain specific annotations:

    • sensor histidine kinase
    • sensor histidine kinase family protein
    • two-component sensor histidine kinase
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • histidine kinase internal region
    • putative sensor kinase protein
    • sensor kinase
    • sensor-like histidine kinase
    • Two-component sensor histidine kinase family protein
    • Two-component sensor kinase
  • strand?: -
  • coordinates?: 1352870..1354426
  • synteny block?: BlockID0005990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0224
    08BA02176:
    C248_0207
    11819-97:
    MS7_0209
    71193:
    ST398NM01_0233
    ECT-R 2:
    ECTR2_184
    ED133:
    SAOV_0161
    ED98:
    SAAV_0189
    HO 5096 0412:
    SAEMRSA15_01820
    JH1:
    SaurJH1_0214
    JH9:
    SaurJH9_0208
    JKD6008:
    SAA6008_00192
    JKD6159:
    SAA6159_00198
    LGA251:
    SARLGA251_01870
    M013:
    M013TW_0203
    MRSA252:
    SAR0215
    MSHR1132:
    SAMSHR1132_01890
    MSSA476:
    SAS0199
    Mu3:
    SAHV_0223
    Mu50:
    SAV0224
    MW2:
    MW0199
    RF122:
    SAB0162c
    ST398:
    SAPIG0233
    T0131:
    SAT0131_00209
    TCH60:
    HMPREF0772_10284 (walK)
    TW20:
    SATW20_02240
    USA300_TCH1516:
    USA300HOU_0231
    VC40:
    SAVC_00855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT
    N315            MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT
    NCTC8325        MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT
    Newman          MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT
    USA300_FPR3757  MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRTIHQHVDESQSSLHHT
                    ************************************************************

    COL             EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE
    N315            EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE
    NCTC8325        EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE
    Newman          EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE
    USA300_FPR3757  EKQIQTFITQHNNSFQELDLTNHHDVTATKRELLKLIHQQPATLYYELSGPNQFITNNYE
                    ************************************************************

    COL             HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD
    N315            HLNTKNMYLFSTHQLKFNNSTYMLKIYMANTPRLSEIKKDSRQFALIVDQYDNILYANDD
    NCTC8325        HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD
    Newman          HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD
    USA300_FPR3757  HLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDNRQFALIVDQYDNILYANDD
                    *****************:**********************.*******************

    COL             RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG
    N315            RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG
    NCTC8325        RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG
    Newman          RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG
    USA300_FPR3757  RFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDGITLLIVMAVVLVLLVIFG
                    ************************************************************

    COL             FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI
    N315            FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI
    NCTC8325        FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI
    Newman          FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI
    USA300_FPR3757  FISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSELEEINNYIYDLFESNEQLI
                    ************************************************************

    COL             HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL
    N315            HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL
    NCTC8325        HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL
    Newman          HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL
    USA300_FPR3757  HSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITLSPKLAQTVVQQLSQMLRYSL
                    ************************************************************

    COL             RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK
    N315            RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK
    NCTC8325        RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK
    Newman          RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK
    USA300_FPR3757  RTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMMLQPLIENAIK
                    ************************************************************

    COL             HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH
    N315            HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH
    NCTC8325        HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH
    Newman          HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH
    USA300_FPR3757  HGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQYVRQSLNNDVFDTKHLGLNHLH
                    ************************************************************

    COL             NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
    N315            NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
    NCTC8325        NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
    Newman          NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
    USA300_FPR3757  NKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVDV
                    **************************************