From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001079000
  • symbol?: hptA
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • iron compound ABC transporter iron compound-binding protein
    • iron ABC transporter substrate-binding protein
    • putative iron compound A C transporter, iron compound-binding protein
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane/binding protein
    • periplasmic-iron-binding protein BitC
    • bacterial extracellular solute-binding family protein
    • extracellular solute-binding family protein
    • Ferric iron ABC transporter, iron-binding protein
    • iron (Fe3+) ABC transporter membrane/binding protein
    • iron(III)-binding protein
    • iron ABC transporter periplasmic protein
    • iron compound ABC transporter, iron compound-binding protein, putative
    • iron compound ABC transporter substrate-binding protein
    • periplasmic iron binding protein
    • putative lipoprotein
  • strand?: -
  • coordinates?: 1354423..1355391
  • synteny block?: BlockID0006010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0225
    08BA02176:
    C248_0208
    11819-97:
    MS7_0210
    71193:
    ST398NM01_0234
    ECT-R 2:
    ECTR2_185
    ED133:
    SAOV_0162
    ED98:
    SAAV_0190
    HO 5096 0412:
    SAEMRSA15_01830
    JH1:
    SaurJH1_0215
    JH9:
    SaurJH9_0209
    JKD6008:
    SAA6008_00193
    JKD6159:
    SAA6159_00199
    LGA251:
    SARLGA251_01880
    M013:
    M013TW_0204
    MRSA252:
    SAR0216
    MSHR1132:
    SAMSHR1132_01900
    MSSA476:
    SAS0200
    Mu3:
    SAHV_0224
    Mu50:
    SAV0225
    MW2:
    MW0200
    RF122:
    SAB0163c
    ST398:
    SAPIG0234
    T0131:
    SAT0131_00211
    TCH60:
    HMPREF0772_10283
    TW20:
    SATW20_02250
    USA300_TCH1516:
    USA300HOU_0232
    VC40:
    SAVC_00860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSKIYILLLFLIFLSACANTRHSESDKNVLTVYSPYQSNLIRPILNEFEKQEHVKIEIK
    N315            MKSKIYILLLFLIFLSSCANTRHSESDKNVLTVYSPYQSNLIRPILNEFEKQEHVKIEIK
    NCTC8325        MKSKIYILLLFLIFLSACANTRHSESDKNVLTVYSPYQSNLIRPILNEFEKQEHVKIEIK
    Newman          MKSKIYILLLFLIFLSACANTRHSESDKNVLTVYSPYQSNLIRPILNEFEKQEHVKIEIK
    USA300_FPR3757  MKSKIYILLLFLIFLSACANTRHSESDKNVLTVYSPYQSNLIRPILNEFEKQEHVKIEIK
                    ****************:*******************************************

    COL             HGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDTSVTQQLEDYRSNNKYV
    N315            HGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDTSVTQQLEDYRSNNKYV
    NCTC8325        HGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDTSVTQQLEDYRSNNKYV
    Newman          HGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDTSVTQQLEDYRSNNKYV
    USA300_FPR3757  HGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDTSVTQQLEDYRSNNKYV
                    ************************************************************

    COL             TSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPNTTTTGYQHMRAIYSMHH
    N315            TSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPNTTTTGYQHMRAIYSMHH
    NCTC8325        TSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPNTTTTGYQHMRAIYSMHH
    Newman          TSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPNTTTTGYQHMRAIYSMHH
    USA300_FPR3757  TSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPNTTTTGYQHMRAIYSMHH
                    ************************************************************

    COL             RVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTM
    N315            RVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTM
    NCTC8325        RVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTM
    Newman          RVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTM
    USA300_FPR3757  RVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDARTWKNKGYPVSIVYPIEGTM
                    ************************************************************

    COL             LNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKN
    N315            LNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKN
    NCTC8325        LNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKN
    Newman          LNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKN
    USA300_FPR3757  LNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAKSIRKDVSEQSDQSIENLKN
                    ************************************************************

    COL             IPLIPKSKLPDIPHHKFLEMIQ
    N315            IPLIPKSKLPDIPHHKFLEMIQ
    NCTC8325        IPLIPKSKLPDIPHHKFLEMIQ
    Newman          IPLIPKSKLPDIPHHKFLEMIQ
    USA300_FPR3757  IPLIPKSKLPDIPHHKFLEMIQ
                    **********************