From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001092000
  • symbol?: fadA
  • description?: acetyl-CoA acetyltransferase

      descriptions from strain specific annotations:

    • acetyl-CoA acetyltransferase
    • acetyl-CoA acetyltransferase-like protein
    • putative acyl-CoA acetyltransferase FadA
    • 3-ketoacyl-CoA thiolase
    • 3-ketoacyl-CoA thiolase A, peroxisomal (Beta-ketothiolase A) (Acetyl-CoA acyltransferase A) (Peroxisomal 3-oxoacyl-CoA thiolase A)
    • 3-ketoacyl-CoA transferase
    • acetyl-CoA acetyltransferase homologue
    • acetyl-CoA acetyltransferases family protein
    • Acetyl-CoA C-acetyltransferase
    • acetyl-CoA C-acetyltransferase family protein
    • acetyl-CoA C-acyltransferase FadA
    • putative thiolase
  • strand?: -
  • coordinates?: 1367005..1368189
  • synteny block?: BlockID0006140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0167 (fadA)
    USA300_FPR3757:
    04-02981:
    SA2981_0231
    08BA02176:
    C248_0215 (fadA)
    11819-97:
    MS7_0217
    71193:
    ST398NM01_0241
    ECT-R 2:
    ECTR2_191
    ED133:
    SAOV_0168
    ED98:
    SAAV_0196
    HO 5096 0412:
    SAEMRSA15_01890 (fadA)
    JH1:
    SaurJH1_0221
    JH9:
    SaurJH9_0215
    JKD6008:
    SAA6008_00200 (fadA)
    JKD6159:
    SAA6159_00205 (fadA)
    LGA251:
    SARLGA251_01950 (fadA)
    M013:
    M013TW_0210
    MRSA252:
    SAR0223 (fadA)
    MSHR1132:
    SAMSHR1132_01960
    MSSA476:
    SAS0207
    Mu3:
    SAHV_0230
    Mu50:
    SAV0231
    MW2:
    MW0207
    RF122:
    SAB0170c
    ST398:
    SAPIG0241
    T0131:
    SAT0131_00218
    TCH60:
    HMPREF0772_10274 (fadA)
    TW20:
    SATW20_02320 (fadA)
    USA300_TCH1516:
    USA300HOU_0240
    VC40:
    SAVC_00895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGKFNKNMIEDVIVGTAF
    N315            MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGKFNKNMIEDVIVGTAF
    NCTC8325        MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGKFNKNMIEDVIVGTAF
    Newman          MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGKFNKNMIEDVIVGTAF
    USA300_FPR3757  MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGKFNKNMIEDVIVGTAF
                    ************************************************************

    COL             PEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAANQIMAGQGDILVAGGVE
    N315            PEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAANQIMAGQGDILVAGGVE
    NCTC8325        PEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAANQIMAGQGDILVAGGVE
    Newman          PEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAANQIMAGQGDILVAGGVE
    USA300_FPR3757  PEGLQGQNIARTIALRAGLSDTVPGQTVNRYCSSGLQTIAIAANQIMAGQGDILVAGGVE
                    ************************************************************

    COL             LMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVSREDQDAYAVRSHQRAYD
    N315            LMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVSREDQDAYAVRSHQRAYD
    NCTC8325        LMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVSREDQDAYAVRSHQRAYD
    Newman          LMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVSREDQDAYAVRSHQRAYD
    USA300_FPR3757  LMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVSREDQDAYAVRSHQRAYD
                    ************************************************************

    COL             AQRDGRFKDEIIPIQVNSVEYTNAGPKVHTNIFDQDEFIRPDTTMEALAKLRTVFKADGT
    N315            AQRDGRFKDEIIPIRVNSVEYTNAGPKVHTNIFDQDEFIRPDTTMEALAKLRTVFKADGT
    NCTC8325        AQRDGRFKDEIIPIQVNSVEYTNAGPKVHTNIFDQDEFIRPDTTMEALAKLRTVFKADGT
    Newman          AQRDGRFKDEIIPIQVNSVEYTNAGPKVHTNIFDQDEFIRPDTTMEALAKLRTVFKADGT
    USA300_FPR3757  AQRDGRFKDEIIPIQVNSVEYTNAGPKVHTNIFDQDEFIRPDTTMEALAKLRTVFKADGT
                    **************:*********************************************

    COL             VTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGFKAVGVDPKIMGIGPAYAIPEVL
    N315            VTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGYKAVGVDPKIMGIGPAYAIPEVL
    NCTC8325        MTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGFKAVGVDPKIMGIGPAYAIPEVL
    Newman          VTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGFKAVGVDPKIMGIGPAYAIPEVL
    USA300_FPR3757  VTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGFKAVGVDPKIMGIGPAYAIPEVL
                    :************************************:**********************

    COL             SLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVNGGAIALGHPLGATGAMLTAR
    N315            SLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVNGGAIALGHPLGATGAMLTAR
    NCTC8325        SLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVNGGAIALGHPLGATGAMLTAR
    Newman          SLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVNGGAIALGHPLGATGAMLTAR
    USA300_FPR3757  SLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVNGGAIALGHPLGATGAMLTAR
                    ************************************************************

    COL             LLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR
    N315            LLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR
    NCTC8325        LLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR
    Newman          LLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR
    USA300_FPR3757  LLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR
                    **********************************