Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001094000
  • symbol?: fadD
  • description?: acyl-CoA dehydrogenase

      descriptions from strain specific annotations:

    • acyl-CoA dehydrogenase
    • acyl-CoA dehydrogenase domain-containing protein
    • acyl-CoA dehydrogenase family protein
    • Glutaryl-CoA dehydrogenase
    • acyl-CoA dehydrogenase, middle domain-containing protein
    • acyl-CoA dehydrogenase FadD
    • acyl-CoA dehydrogenase FadD-like protein
    • putative acyl-CoA dehydrogenase
    • acyl-CoA dehydrogenase, N-terminal domain protein
    • pseudogene
    • NRAMP family Mn2+/Fe2+ transporter
  • strand?: -
  • coordinates?: 1370676..1371887
  • synteny block?: BlockID0006160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0169 (fadD)
    USA300_FPR3757:
    04-02981:
    SA2981_0233
    08BA02176:
    C248_0217 (fadD)
    11819-97:
    MS7_0219
    71193:
    ST398NM01_0243
    ECT-R 2:
    ECTR2_193
    ED133:
    SAOV_0170
    ED98:
    SAAV_0198
    HO 5096 0412:
    SAEMRSA15_01910 (fadD)
    JH1:
    SaurJH1_0223
    JH9:
    SaurJH9_0217
    JKD6008:
    SAA6008_00202 (fadD)
    JKD6159:
    SAA6159_00207 (fadD)
    LGA251:
    SARLGA251_01970 (fadD)
    M013:
    M013TW_0212
    MRSA252:
    SAR0225 (fadD)
    MSHR1132:
    SAMSHR1132_01980
    MSSA476:
    SAS0209
    Mu3:
    SAHV_0232
    Mu50:
    SAV0233
    MW2:
    MW0209
    RF122:
    SAB0172c (fadD)
    ST398:
    SAPIG0243
    T0131:
    SAT0131_00220
    TCH60:
    HMPREF0772_10272 (fadD)
    TW20:
    SATW20_02340 (fadD)
    USA300_TCH1516:
    USA300HOU_0242
    VC40:
    SAVC_00905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
    N315            ---------------MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESNYRE
    NCTC8325        ---------------MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
    Newman          MHFTLVFILFLGGIYMTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
    USA300_FPR3757  ---------------MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
                                   *****************************************:***

    COL             NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISLA
    N315            NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISLA
    NCTC8325        NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISLA
    Newman          NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISLA
    USA300_FPR3757  NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISLA
                    ************************************************************

    COL             TLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVAER
    N315            TLLGVHQGLGHNTFYFGGSKEQIAKYVPKLLSHELRTCFALTEPEHGSDVAGGLETVAER
    NCTC8325        TLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVAER
    Newman          TLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVAER
    USA300_FPR3757  TLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVAER
                    ****************************** *****************************

    COL             QGDTWVINGEKKWIGGAHVSDVIPVFAVNKETGKPHCFVVRPEQDGVDIEVIDNKIALRI
    N315            QGDTWVINGEKKWIGGAHVSDVIPVFAVNKKTGKPHCFVVRPEQDGVDIEVIDNKIALRI
    NCTC8325        QGDTWVINGEKKWIGGAHVSDVIPVFAVNKETGKPHCFVVRPEQDGVDIEVIDNKIALRI
    Newman          QGDTWVINGEKKWIGGAHVSDVIPVFAVNKETGKPHCFVVRPEQDGVDIEVIDNKIALRI
    USA300_FPR3757  QGDTWVINGEKKWIGGAHVSDVIPVFAVNKETGKPHCFVVRPEQDGVDIEVIDNKIALRI
                    ******************************:*****************************

    COL             VPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLDYVTE
    N315            VPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLDYVTE
    NCTC8325        VPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLDYVTE
    Newman          VPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLDYVTE
    USA300_FPR3757  VPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLDYVTE
                    ************************************************************

    COL             RKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMMNALRL
    N315            RKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMMNALRL
    NCTC8325        RKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMMNALRL
    Newman          RKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMMNALRL
    USA300_FPR3757  RKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMMNALRL
                    ************************************************************

    COL             RETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGDSAFV
    N315            RETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGDSAFV
    NCTC8325        RETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGDSAFV
    Newman          RETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGDSAFV
    USA300_FPR3757  RETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGDSAFV
                    **********************************************************