From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001102000
  • symbol?: opp-5A
  • description?: nickel ABC transporter nickel-binding protein

      descriptions from strain specific annotations:

    • nickel ABC transporter nickel-binding protein
    • extracellular solute-binding protein
    • ABC transporter substrate-binding protein
    • Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein oppA
    • extracellular solute-binding proteins, family 5 Middle family protein
    • ABC transporter ATP-binding protein
    • bacterial extracellular solute-binding s, 5 Middle family protein
    • extracellular solute-binding lipoprotein
    • putative extracellular solute-bindinglipoprotein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ABC transporter, substrate-binding protein
    • dipeptide-binding protein
    • oligopeptide ABC transporter substrate-binding protein OppA
  • strand?: -
  • coordinates?: 1380694..1382117
  • synteny block?: BlockID0006220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0237
    08BA02176:
    C248_0222
    11819-97:
    MS7_0223
    71193:
    ST398NM01_0248
    ECT-R 2:
    ECTR2_197
    ED133:
    SAOV_0174
    ED98:
    SAAV_0202
    HO 5096 0412:
    SAEMRSA15_01960
    JH1:
    SaurJH1_0227
    JH9:
    SaurJH9_0221
    JKD6008:
    SAA6008_00207
    JKD6159:
    SAA6159_00214
    LGA251:
    SARLGA251_02010
    M013:
    M013TW_0216
    MRSA252:
    SAR0230
    MSHR1132:
    SAMSHR1132_02060
    MSSA476:
    SAS0213
    Mu3:
    SAHV_0236
    Mu50:
    SAV0237
    MW2:
    MW0213
    RF122:
    SAB0176c
    ST398:
    SAPIG0248
    T0131:
    SAT0131_00227
    TCH60:
    HMPREF0772_10267
    TW20:
    SATW20_02390
    USA300_TCH1516:
    USA300HOU_0246
    VC40:
    SAVC_00925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYETDVPVKIGAAESLFKT
    N315            MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYETDVPVKIGAAESLFKT
    NCTC8325        ---------------------MHSSGKDLNISLPLKTKSIAPYETDVPVKIGAAESLFKT
    Newman          MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYETDVPVKIGAAESLFKT
    USA300_FPR3757  MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYETDVPVKIGAAESLFKT
                                         ***************************************

    COL             NDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVKSSLENSMKKSDLVKYS
    N315            NDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVKSSLENSMKKSDLVKYS
    NCTC8325        NDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVKSSLENSMKKSDLVKYS
    Newman          NDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVKSSLENSMKKSDLVKYS
    USA300_FPR3757  NDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVKSSLENSMKKSDLVKYS
                    ************************************************************

    COL             LPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYDTDAKSDVNQTPVGTGPYQIKDYK
    N315            LPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYYTDAKSDVNQTPVGTGPYQIKDYK
    NCTC8325        LPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYDTDAKSDVNQTPVGTGPYQIKDYK
    Newman          LPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYDTDAKSDVNQTPVGTGPYQIKDYK
    USA300_FPR3757  LPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYDTDAKSDVNQTPVGTGPYQIKDYK
                    ************************************ ***********************

    COL             QSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQKDDLITDVPVNKVQDIENN
    N315            QSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQKDDLITDVPVNKVHDIENN
    NCTC8325        QSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQKDDLITDVPVNKVQDIENN
    Newman          QSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQKDDLITDVPVNKVQDIENN
    USA300_FPR3757  QSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQKDDLITDVPVNKVQDIENN
                    ******************************************************:*****

    COL             QNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQGIADHIYQGYAKPATSPFND
    N315            QNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQGIADHIYQGYAKPATSPFND
    NCTC8325        QNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQGIADHIYQGYAKPATSPFND
    Newman          QNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQGIADHIYQGYAKPATSPFND
    USA300_FPR3757  QNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQGIADHIYQGYAKPATSPFND
                    ************************************************************

    COL             KIPYIKEPKLTKQNIEQAKMLLAKDGYTKEHPLKIKLITYDGRPELSKIAQVLQSDAKKA
    N315            KIPYIKEPKLTKQNIEQAKTLLAKDGYTKEHPLKIKLITYDGRPELSKIAQVLQSDAKKA
    NCTC8325        KIPYIKEPKLTKQNIEQAKMLLAKDGYTKEHPLKIKLITYDGRPELSKIAQVLQSDAKKA
    Newman          KIPYIKEPKLTKQNIEQAKMLLAKDGYTKEHPLKIKLITYDGRPELSKIAQVLQSDAKKA
    USA300_FPR3757  KIPYIKEPKLTKQNIEQAKMLLAKDGYTKEHPLKIKLITYDGRPELSKIAQVLQSDAKKA
                    ******************* ****************************************

    COL             NIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGYFFNQAYKKDGAINKGDYNNSN
    N315            NIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGYFFNQAYKKDGAINKGDYNNSN
    NCTC8325        NIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGYFFNQAYKKDGAINKGDYNNSN
    Newman          NIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGYFFNQAYKKDGAINKGDYNNSN
    USA300_FPR3757  NIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGYFFNQAYKKDGAINKGDYNNSN
                    ************************************************************

    COL             VDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIAYNDQIVAANSKVKNYKVTPEGI
    N315            VDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIAYNDQIVAANSKVKNYKVTPEGI
    NCTC8325        VDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIAYNDQIVAANSKVKNYKVTPEGI
    Newman          VDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIAYNDQIVAANSKVKNYKVTPEGI
    USA300_FPR3757  VDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIAYNDQIVAANSKVKNYKVTPEGI
                    ************************************************************

    COL             YLIDYRTTIER
    N315            YLIDYRTTIER
    NCTC8325        YLIDYRTTIER
    Newman          YLIDYRTTIER
    USA300_FPR3757  YLIDYRTTIER
                    ***********