From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001155000
  • symbol?: rbsD
  • description?: D-ribose pyranase

      descriptions from strain specific annotations:

    • D-ribose pyranase
    • high affinity ribose transport protein rbsD
    • Ribose ABC transport system, high affinity permease RbsD
    • D-ribose mutarotase
    • putative ribose transport protein
    • RbsD / FucU transport protein family
    • ribose ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: -
  • coordinates?: 1427056..1427460
  • synteny block?: BlockID0006750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0259 (rbsD)
    NCTC8325:
    Newman:
    NWMN_0203 (rbsD)
    USA300_FPR3757:
    04-02981:
    SA2981_0269 (rbsD)
    08BA02176:
    C248_0259 (rbsD)
    11819-97:
    MS7_0259 (rbsD)
    71193:
    ST398NM01_0284
    ECT-R 2:
    ECTR2_230
    ED133:
    SAOV_0210
    ED98:
    SAAV_0237
    HO 5096 0412:
    SAEMRSA15_02290
    JH1:
    SaurJH1_0260
    JH9:
    SaurJH9_0254
    JKD6008:
    SAA6008_00244 (rbsD)
    JKD6159:
    SAA6159_00248 (rbsD)
    LGA251:
    SARLGA251_02340
    M013:
    M013TW_0250
    MRSA252:
    SAR0267
    MSHR1132:
    SAMSHR1132_02360
    MSSA476:
    SAS0246
    Mu3:
    SAHV_0268 (rbsD)
    Mu50:
    SAV0269 (rbsD)
    MW2:
    MW0245 (rbsD)
    RF122:
    SAB0209c
    ST398:
    SAPIG0284
    T0131:
    SAT0131_00264
    TCH60:
    HMPREF0772_10231 (rbsD)
    TW20:
    SATW20_02720
    USA300_TCH1516:
    USA300HOU_0281 (rbsD)
    VC40:
    SAVC_01090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLE
    N315            MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLE
    NCTC8325        MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLE
    Newman          MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLE
    USA300_FPR3757  MKKSAILNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFIDVLATVLE
                    *****:******************************************************

    COL             EMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGET
    N315            EMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGET
    NCTC8325        EMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGET
    Newman          EMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGET
    USA300_FPR3757  EMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKSNLAHPLNKGNIRTGET
                    ************************************************************

    COL             TPYSNIALESNVTF
    N315            TPYSNIALESNVTF
    NCTC8325        TPYSNIALESNVTF
    Newman          TPYSNIALESNVTF
    USA300_FPR3757  TPYSNIALESNVTF
                    **************