From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001898000
  • symbol?:
  • description?: acetyl-CoA acetyltransferase

      descriptions from strain specific annotations:

    • acetyl-CoA acetyltransferase
    • acetyl-CoA C-acetyltransferase homologue
    • 3-ketoacyl-CoA thiolase
    • acetyl-CoA acyltransferase
    • acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
    • acetyl-CoA acetyltransferase protein
  • strand?: +
  • coordinates?: 2385115..2386293
  • synteny block?: BlockID0012710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0352
    08BA02176:
    C248_0409 (thl)
    11819-97:
    MS7_0344 (thlA)
    71193:
    ST398NM01_0434
    ECT-R 2:
    ECTR2_315
    ED133:
    SAOV_0378
    ED98:
    SAAV_0322
    HO 5096 0412:
    SAEMRSA15_03090 (thl)
    JH1:
    SaurJH1_0412
    JH9:
    SaurJH9_0402
    JKD6008:
    SAA6008_00331 (paaJ)
    JKD6159:
    SAA6159_00328 (paaJ)
    LGA251:
    SARLGA251_03160 (thl)
    M013:
    M013TW_0333
    MRSA252:
    SAR0351 (thl)
    MSHR1132:
    SAMSHR1132_03270
    MSSA476:
    SAS0330
    Mu3:
    SAHV_0351
    Mu50:
    SAV0354
    MW2:
    MW0330
    RF122:
    SAB0304 (th1)
    ST398:
    SAPIG0434
    T0131:
    SAT0131_00361 (infC)
    TCH60:
    HMPREF0772_10140 (atoB)
    TW20:
    SATW20_04220 (thl)
    USA300_TCH1516:
    USA300HOU_0375
    VC40:
    SAVC_01520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
    N315            MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
    NCTC8325        MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
    Newman          MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
    USA300_FPR3757  MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
                    ************************************************************

    COL             QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
    N315            QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
    NCTC8325        QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
    Newman          QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
    USA300_FPR3757  QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
                    ************************************************************

    COL             SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLAEQYGISREEQDTFAV
    N315            SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
    NCTC8325        SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
    Newman          SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
    USA300_FPR3757  SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
                    ********************************************.***************

    COL             NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
    N315            NSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
    NCTC8325        NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
    Newman          NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
    USA300_FPR3757  NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
                    ***:****************************:***************************

    COL             TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
    N315            TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
    NCTC8325        TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
    Newman          TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
    USA300_FPR3757  TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
                    ************************************************************

    COL             LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
    N315            LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
    NCTC8325        LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
    Newman          LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
    USA300_FPR3757  LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
                    *********************** ************************************

    COL             TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
    N315            TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
    NCTC8325        TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
    Newman          TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
    USA300_FPR3757  TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
                    *********************************