From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002107000
  • symbol?: ssl4
  • description?: staphylococcal superantigen-like protein 4

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 4
    • superantigen-like protein
    • staphylococcal exotoxin
    • exotoxin 9
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • superantigen-like protein 11
    • Exotoxin 8
  • strand?: +
  • coordinates?: 2590774..2595324
  • synteny block?: BlockID0014130
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0385 (set9)
    NCTC8325:
    Newman:
    NWMN_0391 (set4nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0400 (set9)
    08BA02176:
    C248_0474
    11819-97:
    MS7_0400
    71193:
    ST398NM01_0492
    ECT-R 2:
    ECTR2_360
    ED133:
    SAOV_0444
    ED98:
    SAAV_0368
    HO 5096 0412:
    JH1:
    SaurJH1_0460
    JH9:
    SaurJH9_0448
    JKD6008:
    SAA6008_00426
    JKD6159:
    LGA251:
    SARLGA251_03630
    M013:
    M013TW_0386
    MRSA252:
    SAR0424
    MSHR1132:
    MSSA476:
    SAS0387
    Mu3:
    SAHV_0422 (set9)
    Mu50:
    MW2:
    MW0385 (set19)
    RF122:
    ST398:
    SAPIG0492
    T0131:
    SAT0131_00463 (rpsD)
    TCH60:
    HMPREF0772_10093
    TW20:
    SATW20_04990
    USA300_TCH1516:
    USA300HOU_0426 (set19)
    VC40:
    SAVC_01750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKITTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNAT
    N315            MKITTIAKTSLALGLLTTGVITTTTQEANATTPSSTKVEAPQSTPPSTKVEAPQSKPNAT
    NCTC8325        MKITTIAKTSLALGLLTTGVITTTTQAANATTLSSTKVEAPQSTPPSTKIEAPQSKPNAT
    Newman          MKITTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNAT
    USA300_FPR3757  MKITTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNAT
                    ************************** ***** ****************:**********

    COL             TPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKF
    N315            TPPSTKVETPQQTPNATTPSSTKV-----------------ETPQSPTTKQVPTEINPKF
    NCTC8325        TPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKF
    Newman          TPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKF
    USA300_FPR3757  TPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKF
                    ********:****.*****.****                 :******************

    COL             KDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNV
    N315            KDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNIVPDYFIYKIALVGKDDKKYDEGVHRNV
    NCTC8325        KDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNV
    Newman          KDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNV
    USA300_FPR3757  KDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNV
                    ********************************:*******************.*******

    COL             DVFVVLEE-NNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQ
    N315            DVFVVLEEKNKYGVERYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQ
    NCTC8325        DVFVVLEE-NNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQ
    Newman          DVFVVLEE-NNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQ
    USA300_FPR3757  DVFVVLEE-NNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQ
                    ******** *:*.:*:********************************************

    COL             ISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVINSEQ
    N315            ISLKELDFKLRKQLIENHNLYGNVGSGKIVINMKNGGKYTFELHKKLQENRMADVIDGTN
    NCTC8325        ISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTN
    Newman          ISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTN
    USA300_FPR3757  ISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTN
                    ****************::*************:************************:. :

    COL             IKNIEVNLK
    N315            IDNIEVNIK
    NCTC8325        IDNIEVNIK
    Newman          IDNIEVNIK
    USA300_FPR3757  IDNIEVNIK
                    *.*****:*