From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002121000
  • symbol?: hsdM1
  • description?: type I restriction enzyme modification protein

      descriptions from strain specific annotations:

    • type I restriction enzyme modification protein
    • type I restriction-modification system DNA-methyltransferase
    • Type I restriction-modification system, DNA-methyltransferase subunit M
    • type I site-specific deoxyribonuclease LldI subunit HsdM
    • type I site-specific deoxyribonuclease LldI chain
    • type I restriction-modification system, M subunit
    • type I restriction modification system modification protein
    • type I site-specific deoxyribonuclease LldI chain hsdM
    • type I restriction-modification system, methyltransferase subunit
    • type I site-specific deoxyribonuclease methyltransferase subunit
    • Type I restriction-modification system methyltransferase subunit
    • Type I restriction-modification system methylation subunit
  • strand?: +
  • coordinates?: 2611715..2613271
  • synteny block?: BlockID0014270
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0476 (hsdM1)
    N315:
    SA0391 (hsdM)
    NCTC8325:
    Newman:
    NWMN_0398 (hsdM)
    USA300_FPR3757:
    04-02981:
    SA2981_0407 (hsdM)
    08BA02176:
    C248_0482 (hsdM)
    11819-97:
    MS7_0406
    71193:
    ST398NM01_0499
    ECT-R 2:
    ECTR2_366 (hsdM)
    ED133:
    SAOV_0451
    ED98:
    SAAV_0374 (hsdM1)
    HO 5096 0412:
    SAEMRSA15_03610
    JH1:
    SaurJH1_0466
    JH9:
    SaurJH9_0454
    JKD6008:
    SAA6008_00434 (hsdM)
    JKD6159:
    LGA251:
    SARLGA251_03690
    M013:
    M013TW_0392
    MRSA252:
    SAR0433
    MSHR1132:
    MSSA476:
    SAS0394
    Mu3:
    SAHV_0429 (hsdM)
    Mu50:
    SAV0431 (hsdM)
    MW2:
    MW0392 (hsdM)
    RF122:
    SAB0384 (hsdM)
    ST398:
    SAPIG0499 (hsdM)
    T0131:
    SAT0131_00470
    TCH60:
    HMPREF0772_10086 (hsdM)
    TW20:
    SATW20_05080
    USA300_TCH1516:
    USA300HOU_0433 (hsdM1)
    VC40:
    SAVC_01785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADALS
    N315            MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADALS
    NCTC8325        ----------------------------MDASEFRNYILGLIFYRFLSEKAEQEYADALS
    Newman          MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADALS
    USA300_FPR3757  MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADALS
                                                ********************************

    COL             GEDITYQEAWADEEYREDLKAELIDQVGYFIEPEDLFSAMIREIETQDFDIEHLATAIRK
    N315            GEDITYQEAWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREIETQDFDIEHLATAIRK
    NCTC8325        GEDITYQEAWADEEYREDLKAELIDQVGYFIEPEDLFSAMIREIETQDFDIEHLATAIRK
    Newman          GEDITYQEAWADEEYREDLKAELIDQVGYFIEPEDLFSAMIREIETQDFDIEHLATAIRK
    USA300_FPR3757  GEDITYQEAWADEEYREDLKAELIDQVGYFIEPEDLFSAMIREIETQDFDIEHLATAIRK
                    *********************************:**************************

    COL             VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
    N315            VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
    NCTC8325        VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
    Newman          VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
    USA300_FPR3757  VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
                    ************************************************************

    COL             LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
    N315            LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
    NCTC8325        LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
    Newman          LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
    USA300_FPR3757  LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
                    ************************************************************

    COL             VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
    N315            VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
    NCTC8325        VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
    Newman          VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
    USA300_FPR3757  VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
                    ************************************************************

    COL             NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
    N315            NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
    NCTC8325        NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
    Newman          NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
    USA300_FPR3757  NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
                    ************************************************************

    COL             RGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
    N315            RGAAEGVIRRYLIEEKNYLEAVIGLPVNIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
    NCTC8325        RGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
    Newman          RGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
    USA300_FPR3757  RGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
                    **************************.*********************************

    COL             FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
    N315            FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
    NCTC8325        FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
    Newman          FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
    USA300_FPR3757  FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
                    ************************************************************

    COL             PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    N315            PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    NCTC8325        PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    Newman          PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
    USA300_FPR3757  PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE
                    **************************************