From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002198000
  • symbol?: dnaX
  • description?: DNA polymerase III subunits gamma and tau

      descriptions from strain specific annotations:

    • DNA polymerase III subunits gamma and tau
    • DNA polymerase III gamma and tau subunits
    • DNA polymerase III, gamma and tau subunits
    • DNA polymerase III gamma subunit
    • DNA polymerase III subunit tau
    • DNA-directed DNA polymerase III subunit gamma and tau
    • DNA-directed DNA polymerase III gamma and tau subunits
    • DNA polymerase III, tau subunit
    • DNA polymerase III, subunit gamma and tau
    • DNA polymerase III subunit gamma/tau DnaX
  • strand?: +
  • coordinates?: 2702997..2704694
  • synteny block?: BlockID0014990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0520 (dnaX)
    N315:
    SA0436 (dnaX)
    NCTC8325:
    Newman:
    NWMN_0442 (dnaX)
    USA300_FPR3757:
    04-02981:
    SA2981_0453 (dnaX)
    08BA02176:
    C248_0529 (dnaX)
    11819-97:
    MS7_0452 (dnaX)
    71193:
    ST398NM01_0544
    ECT-R 2:
    ECTR2_413 (dnaX)
    ED133:
    SAOV_0496
    ED98:
    SAAV_0422 (dnaX)
    HO 5096 0412:
    SAEMRSA15_04040 (dnaX)
    JH1:
    SaurJH1_0512
    JH9:
    SaurJH9_0499
    JKD6008:
    SAA6008_00482 (dnaX)
    JKD6159:
    SAA6159_00427 (dnaX)
    LGA251:
    SARLGA251_04110 (dnaX)
    M013:
    M013TW_0443
    MRSA252:
    SAR0477 (dnaX)
    MSHR1132:
    SAMSHR1132_04220
    MSSA476:
    SAS0435
    Mu3:
    SAHV_0475 (dnaX)
    Mu50:
    SAV0478 (dnaX)
    MW2:
    MW0433 (dnaX)
    RF122:
    SAB0427 (dnaX)
    ST398:
    SAPIG0544
    T0131:
    SAT0131_00519
    TCH60:
    HMPREF0772_10044 (dnaX)
    TW20:
    SATW20_05460 (dnaX)
    USA300_TCH1516:
    USA300HOU_0477 (dnaZX)
    VC40:
    SAVC_01975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYQALYRMYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSGPRGTGKTSIAKVFAK
    N315            MNYQALYRMYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSGPRGTGKTSIAKVFAK
    NCTC8325        --------MYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSGPRGTGKTSIAKVFAK
    Newman          MNYQALYRMYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSGPRGTGKTSIAKVFAK
    USA300_FPR3757  --------MYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSGPRGTGKTSIAKVFAK
                            ****************************************************

    COL             AINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEIRNIRDKVKYAPSESKY
    N315            AINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEIRNIRDKVKYAPSESKY
    NCTC8325        AINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEIRNIRDKVKYAPSESKY
    Newman          AINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEIRNIRDKVKYAPSESKY
    USA300_FPR3757  AINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEIRNIRDKVKYAPSESKY
                    ************************************************************

    COL             KVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIPPTIISRAQRFDFKAISL
    N315            KVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIPPTIISRAQRFDFKAISL
    NCTC8325        KVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIPPTIISRAQRFDFKAISL
    Newman          KVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIPPTIISRAQRFDFKAISL
    USA300_FPR3757  KVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIPPTIISRAQRFDFKAISL
                    ************************************************************

    COL             DQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMDQAIAFGDGTLTLQDALNV
    N315            DQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMDQAIAFGDGTLTLQDALNV
    NCTC8325        DQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMDQAIAFGDGTLTLQDALNV
    Newman          DQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMDQAIAFGDGTLTLQDALNV
    USA300_FPR3757  DQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMDQAIAFGDGTLTLQDALNV
                    ************************************************************

    COL             TGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRLINDMIYFVRDTIMNKTSEK
    N315            TGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRLINDMIYFVRDTIMNKTSEK
    NCTC8325        TGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRLINDMIYFVRDTIMNKTSEK
    Newman          TGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRLINDMIYFVRDTIMNKTSEK
    USA300_FPR3757  TGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRLINDMIYFVRDTIMNKTSEK
                    ************************************************************

    COL             DTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFEVLLVKLAEQIKGQPQVIANV
    N315            DTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFEVLLVKLAEQIKGQPQVIANV
    NCTC8325        DTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFEVLLVKLAEQIKGQPQVIANV
    Newman          DTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFEVLLVKLAEQIKGQPQVIANV
    USA300_FPR3757  DTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFEVLLVKLAEQIKGQPQVIANV
                    ************************************************************

    COL             AEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPVQKSSKKPARGIQKSKNAFSMQ
    N315            AEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPAQKSSKKPARGIQKSKNAFSMQ
    NCTC8325        AEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPVQKSSKKPARGIQKSKNAFSMQ
    Newman          AEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPVQKSSKKPARGIQKSKNAFSMQ
    USA300_FPR3757  AEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPVQKSSKKPARGIQKSKNAFSMQ
                    **************************************.*********************

    COL             QIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVSLLQNSEPVAASEDHVLVKFEEE
    N315            QIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVSLLQNSEPVAASEDHVLVKFEEE
    NCTC8325        QIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVSLLQNSEPVAASEDHVLVKFEEE
    Newman          QIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVSLLQNSEPVAASEDHVLVKFEEE
    USA300_FPR3757  QIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVSLLQNSEPVAASEDHVLVKFEEE
                    ************************************************************

    COL             IHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQWQRVRTEYLQNRKNEGDDMPKQQ
    N315            IHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQWQRVRTEYLQNRKNEGDDMPKQQ
    NCTC8325        IHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQWQRVRTEYLQNRKNEGDDMPKQQ
    Newman          IHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQWQRVRTEYLQNRKNEGDDMPKQQ
    USA300_FPR3757  IHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQWQRVRTEYLQNRKNEGDDMPKQQ
                    ************************************************************

    COL             AQQTDIAQKAKDLFGEETVHVIDEE
    N315            AQQTDIAQKAKDLFGEETVHVIDEE
    NCTC8325        AQQTDIAQKAKDLFGEETVHVIDEE
    Newman          AQQTDIAQKAKDLFGEETVHVIDEE
    USA300_FPR3757  AQQTDIAQKAKDLFGEETVHVIDEE
                    *************************