From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002242000
  • symbol?: rplY
  • description?: 50S ribosomal protein L25/general stress protein Ctc

      descriptions from strain specific annotations:

    • 50S ribosomal protein L25/general stress protein Ctc
    • 50S ribosomal protein L25
    • 50S ribosomal protein L25 Ctc-form
    • 50S ribosomalprotein L25p
    • putative 50S ribosomal protein L25
    • ribosomal Protein L25
    • ribosomal protein L25, Ctc-form
  • strand?: +
  • coordinates?: 2747986..2748651
  • synteny block?: BlockID0015410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0545 (rplY)
    N315:
    SA0459 (rplY)
    NCTC8325:
    Newman:
    NWMN_0464 (rplY)
    USA300_FPR3757:
    04-02981:
    SA2981_0476 (rplY)
    08BA02176:
    C248_0556 (rplY)
    11819-97:
    MS7_0478
    71193:
    ST398NM01_0567
    ECT-R 2:
    ECTR2_441
    ED133:
    SAOV_0523
    ED98:
    SAAV_0448 (rplY)
    HO 5096 0412:
    SAEMRSA15_04270 (rplY)
    JH1:
    SaurJH1_0536
    JH9:
    SaurJH9_0523
    JKD6008:
    SAA6008_00506 (rplY)
    JKD6159:
    SAA6159_00452 (rplY)
    LGA251:
    SARLGA251_04350 (rplY)
    M013:
    M013TW_0473
    MRSA252:
    SAR0502 (rplY)
    MSHR1132:
    SAMSHR1132_04450
    MSSA476:
    SAS0458
    Mu3:
    SAHV_0498 (rplY)
    Mu50:
    SAV0501 (rplY)
    MW2:
    MW0456 (rplY)
    RF122:
    SAB0450 (prs)
    ST398:
    SAPIG0567
    T0131:
    SAT0131_00547
    TCH60:
    HMPREF0772_10018 (rplY)
    TW20:
    SATW20_05690 (rplY)
    USA300_TCH1516:
    USA300HOU_0495 (rplY)
    VC40:
    SAVC_02090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGV
    N315            MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGV
    NCTC8325        MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGV
    Newman          MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGV
    USA300_FPR3757  MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGV
                    ************************************************************

    COL             IELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGV
    N315            IELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGV
    NCTC8325        IELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGV
    Newman          IELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGV
    USA300_FPR3757  IELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGV
                    ************************************************************

    COL             VEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVA
    N315            VEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVA
    NCTC8325        VEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVA
    Newman          VEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVA
    USA300_FPR3757  VEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVA
                    ************************************************************

    COL             PTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE
    N315            PTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE
    NCTC8325        PTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE
    Newman          PTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE
    USA300_FPR3757  PTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE
                    *************************************