From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002340000
  • symbol?:
  • description?: glycosyl transferase family 1

      descriptions from strain specific annotations:

    • glycosyl transferase family 1
    • glycosyl transferase, group 1 family protein
    • poly (glycerol-phosphate) alpha-glucosyltransferase
    • putative glycosyl transferase
    • glycoside hydrolase family protein
    • glycosyltransferase
    • glycosyl transferase family protein
    • glycosyl transferases group 1 family protein
    • group 1 glycosyl transferase
  • strand?: -
  • coordinates?: 2879472..2880965
  • synteny block?: BlockID0016390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0542
    08BA02176:
    C248_0640
    11819-97:
    MS7_0555
    71193:
    ST398NM01_0640
    ECT-R 2:
    ECTR2_519
    ED133:
    SAOV_0600c
    ED98:
    SAAV_0528
    HO 5096 0412:
    SAEMRSA15_04920
    JH1:
    SaurJH1_0602
    JH9:
    SaurJH9_0588
    JKD6008:
    SAA6008_00573
    JKD6159:
    SAA6159_00519
    LGA251:
    SARLGA251_05010
    M013:
    M013TW_0552
    MRSA252:
    SAR0569
    MSHR1132:
    SAMSHR1132_05090
    MSSA476:
    SAS0523
    Mu3:
    SAHV_0563
    Mu50:
    SAV0565
    MW2:
    MW0520
    RF122:
    SAB0515c
    ST398:
    SAPIG0640
    T0131:
    SAT0131_00626
    TCH60:
    HMPREF0772_12624
    TW20:
    SATW20_06350
    USA300_TCH1516:
    USA300HOU_0559
    VC40:
    SAVC_02415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
    N315            MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
    NCTC8325        MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
    Newman          MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
    USA300_FPR3757  MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYLYRNAQNYITSSDYIN
                    ************************************************************

    COL             MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
    N315            MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
    NCTC8325        MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
    Newman          MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
    USA300_FPR3757  MYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYDQERFLMYAHFQDPKYR
                    ************************************************************

    COL             ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
    N315            ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
    NCTC8325        ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
    Newman          ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
    USA300_FPR3757  ILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFFYNPEGDTKLEKYFSYKD
                    ************************************************************

    COL             GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
    N315            GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
    NCTC8325        GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
    Newman          GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
    USA300_FPR3757  GKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFSDRNVYTAPIFNLTPESIP
                    ************************************************************

    COL             VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPVV
    N315            VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPIV
    NCTC8325        VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPVV
    Newman          VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPVV
    USA300_FPR3757  VVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVSTEQQKLDVEKRINHTIPVV
                    **********************************************************:*

    COL             NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
    N315            NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
    NCTC8325        NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
    Newman          NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
    USA300_FPR3757  NIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQIELIKRLVSYVPKIELHMYGF
                    ************************************************************

    COL             GSESKKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLSLITSNMEGFSLALLESLAHGV
    N315            GSESKKLNELIQKYGLENHVYLRGFLSNLNQEYSDAYLSLITSNMEGFSLALLESLAHGV
    NCTC8325        GSESKKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLSLITSNMEGFSLALLESLAHGV
    Newman          GSESKKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLSLITSNMEGFSLALLESLAHGV
    USA300_FPR3757  GSESKKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLSLITSNMEGFSLALLESLAHGV
                    *****************************:******************************

    COL             PVISYDIKYGPNELITSDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
    N315            PVISYDIKYGPNELITPDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
    NCTC8325        PVISYDIKYGPNELITSDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
    Newman          PVISYDIKYGPNELITSDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
    USA300_FPR3757  PVISYDIKYGPNELITSDFNGYLITKNDEDALFDKVKYVIDHPEVQQRLSKGSLAKAQQY
                    ****************.*******************************************

    COL             SKASLIKQWDQFVRLI
    N315            SKASLIKQWDQFVRLI
    NCTC8325        SKASLIKQWDQFVRLI
    Newman          SKASLIKQWDQFVRLI
    USA300_FPR3757  SKASLIKQWDQFVRLI
                    ****************